KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349924
Entry
4349924           CDS       T01015                                 
Name
(RefSeq) DExH-box ATP-dependent RNA helicase DExH10
  KO
K12598  ATP-dependent RNA helicase DOB1 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4349924
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4349924
   03041 Spliceosome [BR:osa03041]
    4349924
   03009 Ribosome biogenesis [BR:osa03009]
    4349924
   03016 Transfer RNA biogenesis [BR:osa03016]
    4349924
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4349924
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     4349924
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    4349924
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    4349924
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    4349924
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    4349924
SSDB
Motif
Pfam: rRNA_proc-arch DSHCT DEAD Helicase_C ATPase_2
Other DBs
NCBI-GeneID: 4349924
NCBI-ProteinID: XP_015617002
UniProt: Q53PH9 B9G9P0
LinkDB
Position
11:complement(3801449..3808587)
AA seq 1003 aa
MEEVENTSKRKAPESEHAAAVSGEHPPPPPPPDAAAKRRNLSRSCIHEVAVPKGYAAAKD
EAVHGTLSSPAFHGEMAKAYPFQLDPFQSVSIACLERNESVLVSAHTSAGKTAIAEYAIA
MSFRDKQRVIYTSPLKALSNQKYRELSQEFSDVGLMTGDVTLQPNATCLVMTTEILRAML
YRGSEVIKEVAWVIFDEIHYMKDRERGVVWEESIIFLPPAIKMVFLSATMSNATEFAEWI
CNLHKQPCHVVYTDFRPTPLQHYVFPIGGSGLYLVVDEDGQFREDNFLKLQDTFTKQSNQ
VDGRKGGGPKASGRIAKGGSASGNSDIYRIVKMIMERKFQPVIIFSFSRRECEHHAMSMS
KLDFNTDEEKDNIEQVFSSAILCLSEEDRGLPAIELMLPLLKRGIAVHHSGLLPLIKELV
ELLFQEGLVKALFATETFAMGLNMPAKTVVFTSVKKWDGDTNRYIASGEYIQMSGRAGRR
GKDIRGICVIMIDEKMEMSVIKDMVLGKPAPLVSTFRLSYYTILNLMSRVEGQFTAEHVI
RNSFHQFQYEKALPEVVQKITSLENEATLLDSSGETDLAEYHKLGLDISELEKKIMSEMI
RPERALLYLVPGRLVKVRDGSTDWGWGVVVNVVKKPPQSGTLPPALSASRGNNYIVDTLL
HCSSSSNENGSRSKPLPPRPGEKGEMHVVPVPLPLLSGLSSVRINIPPDLRPPEARQNIL
FAVQELGKRYPQGLPKLDPIKDMGLQEPELVELVHKLDDLEQKLCSHPLHKSDQSEQQLS
WYQRKAELNHEIQMLKSKMRDSQLQKFRDELRNRSRVLKMLGHIDADGVLQLKGRAACLI
DTGDELLITELMFNGTFNDLDHHQVASLASCFIPCEKSSEQIRLRSELSTPMMQLQEAAR
KIAEVQKECKLEVNVEEYVESTCRPYLMDVIYCWSKGATFGEVIEMTDIFEGSIIRLARR
LDEFLNQLKAAAQAVGEVNLENKFGAASDSLRRGIMFANSLYL
NT seq 3012 nt   +upstreamnt  +downstreamnt
atggaggaggtggagaacacgagcaagcggaaggcgccggagagcgagcacgccgccgcc
gtctcgggggagcatccgccgcctccgccgccgcctgacgcggcggcgaagcggcggaac
ctgtcgcggtcgtgcatccacgaggtggcggtgcccaagggctacgccgcggccaaggac
gaggcggtgcacgggacgctctcgagcccggccttccatggcgagatggccaaggcctac
ccgttccagctcgaccccttccagagcgtctccatcgcctgcctcgagcgcaacgagtcg
gtgctcgtctccgcccacacctcggcggggaagaccgccattgccgagtacgccatcgcc
atgtcgttccgggacaagcagagggtcatatacacctcccctctcaaggccctgagcaac
cagaagtacagggagctcagccaggagttctccgatgtcggattgatgaccggcgatgtc
acgctgcagccgaacgcgacttgcctcgtcatgaccacggagatcctcagggcaatgctc
tacagggggtccgaggtgatcaaggaggttgcctgggttatctttgatgagatccactac
atgaaggatcgcgagcgcggggtcgtgtgggaggagagtataatcttcctgccacctgcc
atcaagatggtgttcctctctgccaccatgtcgaacgcgaccgagtttgccgagtggata
tgcaatctgcacaagcaaccttgtcatgtggtgtatactgacttcaggccgacaccgtta
cagcactatgtgttcccgattggcggctccggtctctaccttgtagtagatgaggatggc
caattcagagaggataattttttgaagctgcaagacacgttcacaaagcaaagtaatcaa
gtggatggaaggaagggtggtggacctaaagccagtggtcgaatagcaaagggcggaagt
gcctctggaaattcggacatatacagaatcgtcaagatgattatggaacggaagtttcaa
ccggtcataattttcagctttagcagaagagaatgtgaacaccatgccatgtcaatgtca
aaacttgacttcaacactgatgaagaaaaagataacatcgaacaggttttcagcagtgct
attctatgtttaagtgaggaagatagaggtttgcctgctatagagttgatgttgcctctt
cttaaacgaggtattgcagttcaccattctggattgcttccattaattaaagagctggtg
gagttgctcttccaagaaggccttgtaaaagctctctttgctactgaaacatttgccatg
ggactgaatatgcctgcaaaaaccgttgtgttcacgtctgtcaaaaaatgggatggtgat
actaaccgctatattgcttctggagaatatatacagatgagtggaagagctggtcggcgt
ggcaaggatatacgtggaatttgtgttataatgatagatgaaaaaatggagatgagtgtt
ataaaggacatggtgttaggtaaaccagcacctcttgtcagtactttccggctgagctat
tacacaattctcaatttaatgagtcgcgtggagggccagtttactgctgagcatgtgatc
aggaattcattccatcagtttcaatatgagaaggcattgccagaagtggtgcaaaagatt
acatcattggaaaatgaagctaccttacttgattcttctggagagactgatcttgcagaa
tatcataaattggggcttgatatatcggaacttgaaaagaaaatcatgtcggagatgatt
agaccagagagggctttgttatacttggttcctggaaggctggttaaagtgagagatggt
tcaacagactggggatggggtgtggttgtaaatgtggttaagaaacctccacaatctggt
actctccctcctgcactaagtgcatctcgtggtaataactatatagtggataccctgctt
cactgttcttctagttcgaacgagaatggatcccgttcaaagccattgccaccacgccca
ggggagaagggagaaatgcatgtggtgcctgtaccactacctttattatctggtctaagc
agtgttagaatcaacattcctcctgatctacgaccacctgaagcaagacaaaatatactt
tttgcagtgcaagagctgggaaagcggtacccccaaggtcttccaaagctagatccaatc
aaagacatgggtcttcaagaacctgaactagtggagttggttcataagcttgatgatctt
gagcagaaactgtgttctcatccacttcataagtctgatcaaagtgagcagcaactgtca
tggtatcaaagaaaagctgagctaaatcatgaaattcaaatgctaaagtcaaagatgcgg
gattcgcagctacaaaaatttagagatgagcttaggaatcggtcccgtgttctgaagatg
cttggtcacattgatgctgatggtgtgctccagctgaaaggacgtgctgcctgtttaata
gacacaggggatgagctgcttatcactgaacttatgtttaatggtacatttaacgatctt
gatcatcatcaagttgcttcccttgctagctgctttataccttgtgagaagtctagtgaa
caaatacgcctgagaagtgagctttctacaccaatgatgcagctacaggaggctgcgaga
aaaatagctgaggtacaaaaagaatgcaaattagaggtaaatgttgaagaatatgtcgaa
tcaacttgtaggccctacctgatggatgtcatatactgttggtcaaagggggccactttt
ggagaggtgatagaaatgactgacatttttgaaggaagtatcatacggctggctagaaga
ctggatgaatttctgaatcagttgaaagctgctgctcaagctgttggtgaggttaacctt
gagaacaagttcggagcggccagcgacagcttacgtcggggtatcatgttcgccaactca
ttgtatctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268439
Entry
9268439           CDS       T01015                                 
Name
(RefSeq) DExH-box ATP-dependent RNA helicase DExH9
  KO
K12598  ATP-dependent RNA helicase DOB1 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9268439
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9268439
   03041 Spliceosome [BR:osa03041]
    9268439
   03009 Ribosome biogenesis [BR:osa03009]
    9268439
   03016 Transfer RNA biogenesis [BR:osa03016]
    9268439
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9268439
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     9268439
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    9268439
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    9268439
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    9268439
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    9268439
SSDB
Motif
Pfam: rRNA_proc-arch DSHCT DEAD ResIII Helicase_C ATPase_2
Other DBs
NCBI-GeneID: 9268439
NCBI-ProteinID: XP_015620627
LinkDB
Position
12:10458954..10466159
AA seq 1001 aa
MATLKRKADSAAAELASPPPKAPRGSEALAESPSLAGGGSEPVACVHDVSYPEGYDPSAP
ATHLLNGVGGAEGAGPAKTFPFQLDPFQAEAIRCLDNGESVMVSAHTSAGKTVVALYAIA
MSLRNQQRVIYTSPIKALSNQKYREFKEEFSDVGLMTGDVTIEPNASCLVMTTEIWRSMQ
YKGSEVMREVAWIIFDEVHYMRDRERGVVWEESIVMAPKNSRFVFLSATVPNAKEFADWV
AKVHKQPCHIVYTDYRPTPLQHYVFPSGGDGLYLVVDEKSKFREDSFQKGLNALVPASEN
DKKRENGKWQKGLLTGKPSEDSDIFKMVKMIIQRQYDPVILFSFSKRECEFLAMQMAKMD
LNDDDEKANIETIFWSAMDLLSDDDKKLPQVSNMLPLLKRGIGVHHSGLLPILKEVIEIL
FQEGLIKCLFATETFSIGLNMPAKTVVFTNVRKFDGDRFRWLSSGEYIQMSGRAGRRGID
QRGICILMVDEKMEPSTAKMILKGSADSLNSAFHLSYNMLLNQIRCEDGDPEKLLRHSFY
QFQADRVLPDLEKQVKELELERNSMIIEEEENLKSYYDLLQQYKNLKKDVRDIVHSPKYV
LPFLQPGRLARVQYSTDEQSTFSIDENITWGVTINFEKVKTHSEDRRPEDSDYTVDVLTR
CSVSKDKSGKKTMKIIPLKDRGEPVVISLPLSQIDGLSSIRMHIPKDLLPVEARENTLRK
VDEVISRFAKDGIPLLDPEEDMKVQSSSFRKASRRIEALESLFEKHDVHNSPHIKQKLKV
LHAKQELSTKIKAIKRTMRSSTALAFKDELKARKRVLRRLGYITSEDVVEVKGKVACEIS
SADELTLTELMFSGTLKDATVEQMVALLSCFVWQEKLQDAPKPREELDLLFFQLQETARR
VANLQLDCKIQIDVESFVNSFRPDIMEAVYSWAKGSKFYQIMEMTQVFEGSLIRAIRRLE
EVLQQLILASKSIGETQLEAKLEEAVSKIKRDIVFAASLYL
NT seq 3006 nt   +upstreamnt  +downstreamnt
atggcgaccctcaagcgtaaggccgattccgcggccgccgagctcgcgtcccctcctccc
aaggccccgcggggctcggaagcactcgctgaatcgccttccctcgccggcgggggcagc
gagcccgtcgcctgcgtgcacgacgtctcctacccggaaggctatgacccgtccgccccc
gccacccacctgctcaacggcgtcggcggcgccgagggtgctgggcctgccaagaccttc
ccgttccagctcgaccccttccaggccgaggccatccgatgcctcgacaacggagaatcc
gtcatggtctcagctcacacatcagctggaaagacagtggttgcattgtatgcaatagca
atgtctttgcgtaatcagcaacgtgtcatctatacatctccaatcaaggctttgagtaac
caaaagtacagggaattcaaagaagagttctctgatgtcggcctcatgactggggatgtt
actattgagccaaatgcatcttgtttggtcatgaccacggaaatttggcgtagcatgcag
tataaaggatcagaagtcatgagggaagtcgcttggattatatttgatgaagtacactac
atgcgtgatagagagagaggagtggtgtgggaggaaagtatagtgatggctcctaagaac
tcacgttttgtgttcctctcagctaccgtgcctaatgccaaggagtttgctgactgggtg
gctaaggtacataagcaaccttgtcatatagtatacactgactaccggcctacacctctc
caacactatgtatttccttctggaggtgatggtttatatctggtagttgatgagaagagc
aagttcagagaggatagttttcagaaaggtttgaatgcgcttgtccctgctagtgagaat
gacaaaaagagggaaaatgggaagtggcagaaaggtctcttgacaggaaaacctagtgag
gacagcgacatattcaagatggtgaagatgataattcagcgtcaatatgacccagtgata
cttttcagctttagcaaaagggagtgtgaatttcttgctatgcagatggctaagatggac
ttgaatgatgatgatgagaaggcaaacattgaaacaattttttggagtgctatggatttg
ctttcagatgatgataagaagcttccccaggtttcaaacatgcttcccttgttgaaacgt
ggcattggtgtacatcattctggtcttttgcccattttgaaggaagtgattgagatactc
ttccaagagggccttatcaagtgcttgtttgccacagaaacattcagtattggtttgaac
atgcctgcaaagactgttgtgtttaccaatgtgcgaaaatttgacggtgatcgattcaga
tggttgtcaagtggagaatacatccagatgagtggccgtgctggtcgccgaggtattgat
cagcgtggtatctgtatattgatggtagatgagaaaatggaaccttcaactgccaaaatg
attctgaaaggaagtgctgatagtttgaacagtgcctttcatttgagctacaatatgttg
ttaaatcaaatacgctgtgaagatggtgatcctgaaaagcttcttcggcactcattttac
caatttcaagctgatcgagttctccctgatcttgagaagcaagtcaaggagctggaacta
gagagaaattccatgattattgaggaggaggagaacctaaagagttattatgatctcttg
cagcagtacaaaaatctaaagaaggatgtccgcgatattgttcattctcctaaatatgtt
ctacctttcttgcaaccaggaaggcttgctcgcgttcagtacagtactgatgagcaatcc
accttctctattgatgaaaacatcacttggggagttacaataaactttgaaaaggtgaaa
acccatagtgaagataggaggcctgaggattccgattacacagttgatgttctcacaaga
tgttctgtaagcaaggacaaaagtggaaagaagacaatgaagattattcctctgaaagac
cgtggagaaccagttgtgatttccttgccactttctcagattgatggactaagcagcatt
cggatgcacataccaaaggatcttttgcctgtagaagctcgagaaaacacattgaggaaa
gttgatgaagttatttccaggtttgctaaagatgggatccctttattggatccagaagag
gatatgaaagtacaatcaagctctttccggaaagcttccagaagaatagaagctcttgaa
agtttatttgagaagcacgatgtccacaattctccacatattaaacaaaagctaaaagtg
ttgcatgctaagcaagaattatcaaccaaaataaaggccattaaaagaacaatgcggtct
tccactgctttagccttcaaggatgagctcaaggcccgaaaacgggttcttcgtagactg
ggatatattacaagtgaggatgttgtggaagtgaagggcaaagtagcatgcgagataagt
tctgctgatgagctaacattgacagagcttatgtttagcggcactctgaaggatgctaca
gtagaacagatggtagcgctgctttcttgctttgtttggcaggaaaagcttcaggatgcc
ccaaagccaagggaggagctcgacttgctgttcttccagttgcaggagacagctagaagg
gttgctaaccttcagcttgactgcaagatccaaattgacgtggagagttttgtgaactct
ttccggcctgatataatggaagcggtgtattcatgggccaaaggatccaaattctatcaa
atcatggagatgacccaagtatttgagggcagcttgatcagggccatcagaaggcttgag
gaggtcctgcaacagctaattctggcatcgaaatccatcggtgaaacccaattggaagca
aaacttgaggaggctgtcagtaagatcaagagggatatagtgtttgcagcatctttatac
ctgtaa

DBGET integrated database retrieval system