KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349968
Entry
4349968           CDS       T01015                                 
Name
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4349968
   03410 Base excision repair
    4349968
   03420 Nucleotide excision repair
    4349968
   03430 Mismatch repair
    4349968
   03440 Homologous recombination
    4349968
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4349968
   03400 DNA repair and recombination proteins [BR:osa03400]
    4349968
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4349968
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4349968
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4349968
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4349968
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 divDNApol
Other DBs
NCBI-GeneID: 4349968
NCBI-ProteinID: XP_015617044
UniProt: Q9LRE6
LinkDB
Position
11:complement(4387460..4397803)
AA seq 1105 aa
MSSGGRGGKRRGAPPPGPSGAAAKRAHPGGTPQPPPPAATAAAPVAEEEDMMDEDVFLDE
TILAEDEEALLLLDRDEALASRLSRWRRPALPADLASGCSRNVAFQQLEIDYVIGESHKV
LLPNSSGPAAILRIFGVTREGHSVCCQVHGFEPYFYISCPMGMGPDDISRFHQTLEGRMK
DSNRNSNVPRFVKRIELVQKQTIMHYQPQQSQPFLKIVVALPTMVASCRGILERGITIEG
LGSKSFLTYESNILFALRFMIDCNIVGGNWIEVPAGKYMKAARIMSYCQLELDCLYSDLV
SHAAEGEHSKMAPFRILSFDIECAGRKGHFPEPTHDPVIQIANLVTLQGEGQPFVRNVMT
LKSCSPIVGVDVMSFDTERDVLLAWRDFIREVDPDIIIGYNICKFDLPYLIERAEVLKIV
EFPILGRIRNSRVRVRDTTFSSRQYGMRESKDVAVEGRVQFDLLQAMQRDYKLSSYSLNS
VSAHFLGEQKEDVHHSIISDLQNGNSETRRRLAVYCLKDAYLPQRLLDKLMYIYNYVEMA
RVTGVPISFLLSRGQSIKVLSQLLRKAKQKNLVIPNIKGQASGQDTFEGATVLEARAGFY
EKPIATLDFASLYPSIMMAYNLCYCTLVPPEDARKLNLPPESVNKTPSGETFVKPDVQKG
ILPEILEELLAARKRAKADLKEAKDPFERAVLDGRQLALKISANSVYGFTGATVGQLPCL
EISSSVTSYGRQMIEHTKKLVEDKFTTLGGYEHNAEVIYGDTDSVMVQFGVSTVEDAMKL
GREAADYISGTFIKPIKLEFEKIYFPYLLISKKRYAGLYWTNPEKFDKMDTKGIETVRRD
NCLLVKNLVTECLHKILVDRDVPGAVQYVKNTISDLLMNRVDLSLLVITKGLTKTGEDYA
VKAAHVELAERMRKRDAATAPTVGDRVPYVIIKAAKGAKAYERSEDPIYVLDNNIPIDPQ
YYLENQISKPLLRIFEPILKNASRELLHGSHTRAVSISTPSNSGIMKFAKKQLTCLGCKA
VISGSNQTLCFHCKGREAELYCKTVGNVSELEMLFGRLWTQCQECQGSLHQDVLCTSRDC
PIFYRRRKAQKDMAEARVQLQRWDF
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgagctcaggcggacgcggcggcaagcggcgaggggcgccgcccccggggccatccggg
gcggcggcgaagcgggcccaccccggtggcaccccgcagccgcctccgcccgccgcgacg
gcggcggcgcccgtggcggaggaggaggacatgatggacgaggacgtcttcctcgacgag
accatcctggcggaggacgaggaggcgttgctgctgctcgaccgggacgaggccctcgcc
tcacgcctctcccgctggaggcgccccgcgctccccgccgacctagcgtccggctgctcg
cgcaatgttgcttttcagcagctggagatagattatgttattggtgagagccacaaagta
ctgctccccaactcatctggtcctgcagctatactcaggatatttggcgtaactagagaa
ggtcacagtgtatgctgccaagtgcatggatttgagccatatttctacatcagttgtcca
atggggatgggccctgatgatatttcacgcttccaccaaacactagaggggaggatgaag
gattcaaataggaacagcaacgtgccaaggtttgtgaagagaatcgaacttgtgcagaag
cagacaatcatgcattaccaaccacagcaatctcagcctttcctcaagatagtggttgct
ttgccaacaatggttgctagttgtcgcggcatcctggaaaggggcataacaattgaaggc
cttggttcgaagagttttctgacatatgaaagcaacattctttttgcacttcgcttcatg
attgactgcaatattgttggtggtaattggattgaagttcctgccggaaagtatatgaag
gcagctcgtatcatgtcctattgtcagctagagttggattgcctatattcggatttggta
agccatgctgctgaaggagaacattctaagatggctccatttcgcatattaagttttgat
attgaatgtgccggtcgcaaaggtcacttcccagaaccaactcatgatcccgttattcag
atagctaacttggtcacccttcaaggagaaggacaaccttttgtacgcaatgttatgacg
cttaaatcatgttctcccattgttggagttgatgttatgtcatttgacacagagagggat
gttctacttgcttggagggatttcatacgtgaagtggaccctgatattattattggatac
aatatctgcaaatttgacttaccctatcttattgagagagctgaagttcttaagatagta
gagtttccaatacttggacgaatcagaaatagtcgtgttcgtgtccgtgacacaactttc
tcttcaaggcaatatggtatgcgtgaaagtaaagatgtagcagtggaaggaagagtacaa
tttgatcttctgcaggctatgcaacgggattacaagcttagttcttattcattaaactct
gtatctgcacatttcctcggggagcaaaaagaggatgttcatcactcaattatatctgat
cttcaaaatgggaattcagagacacgaagacggcttgcggtttattgtttgaaggatgcc
tatcttccacaacgactgctagataagttgatgtatatctacaactatgtggaaatggca
agagtcactggagttcccatttcatttcttctttcaaggggacagagcattaaggtcctc
tcacagctactcaggaaagcaaaacagaaaaaccttgttataccaaatataaagggtcaa
gcgtctggacaggatacctttgaaggtgcaactgttttggaggcaagggctggattttat
gagaaacccattgcgactttggactttgcttcgttgtatccatccatcatgatggcatat
aacctatgctactgtactttggtcccccctgaggatgcccgcaaactcaacctgcctcca
gaaagtgtcaacaaaaccccatctggtgaaacatttgtgaaaccagatgtgcaaaagggt
atacttcctgaaatccttgaagaattgttggctgctcggaaaagggcgaaagcagatttg
aaggaagcaaaggatccatttgaaagggccgttcttgatggtcgtcagcttgccctaaaa
ataagcgcaaactctgtctatggttttactggagcgactgttggtcaattaccttgttta
gaaatttcttcaagtgtgaccagctatggtcgacagatgattgaacatacaaaaaagctt
gttgaagataaattcacgacacttggaggctatgagcacaatgcagaggtcatctatgga
gatactgattctgtaatggtacagttcggtgtttctactgttgaggacgcaatgaagcta
ggaagagaagctgcagactacattagtggaacatttattaagcccatcaagcttgagttt
gagaagatctatttcccttatctactgattagcaagaagagatatgctggtttgtactgg
acaaatcctgagaaatttgacaaaatggacacgaaaggtattgaaacagtgagaagggac
aactgtttattagtaaagaacctggttactgagtgccttcataaaatactagtggacaga
gatgttcctggtgcagttcaatatgtcaagaacaccatttctgatctactaatgaaccgt
gtagacttatctcttctagttataacaaagggtttgactaaaacaggagaggattatgct
gtcaaagctgcccatgtggagcttgctgagagaatgcgaaagagggacgctgctactgct
cctactgttggtgaccgggttccttatgttataatcaaagcagcaaaaggggcaaaggca
tatgagaggtcagaagatcctatttatgttttggataataacataccaatagatccccaa
tactaccttgagaaccaaatcagcaaaccacttttgaggatctttgagccgattctgaag
aatgccagtagagagctgcttcatggaagtcacaccagggctgtttcaatctcaactcct
tcaaatagtggaataatgaaatttgcaaagaaacaattgacatgcctcggatgcaaagca
gttataagtggttccaatcaaacgctttgctttcattgcaagggaagagaagcagagtta
tactgcaaaactgtaggaaacgtttctgagctggagatgctctttgggaggctctggacg
cagtgccaggagtgccaaggctcccttcatcaggacgttctctgcacaagccgggattgt
cctattttctaccgccgaagaaaggcgcagaaggatatggctgaagctagagtacagctt
caacgttgggacttctga

DBGET integrated database retrieval system