KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349985
Entry
4349985           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC5
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4349985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4349985
   03400 DNA repair and recombination proteins [BR:osa03400]
    4349985
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4349985
  RNA polymerase III system
   RNA polymerase III
     4349985
  RNA polymerase I system
   RNA polymerase I
     4349985
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4349985
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 4349985
NCBI-ProteinID: XP_015615830
UniProt: A0A0P0XZX0 Q53LH8
LinkDB
Position
11:4731905..4734094
AA seq 74 aa
MIIPVRCFTCGKVIGNKWDLYLDLLQADYTEGDALDALGLVRYCCRRMLMTHVDLIEKLL
NYNTLEKTETTAGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atgatcataccagtgcgctgcttcacctgcggcaaggtgatcggcaacaagtgggatctc
tacctcgacctcctccaggcagactacaccgagggggatgctctggatgctttgggctta
gtccgttactgctgtaggcgaatgctgatgacccatgttgacctcattgagaagctgctc
aactacaacactctggagaagactgagaccactgctggcaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351671
Entry
4351671           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC5
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4351671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4351671
   03400 DNA repair and recombination proteins [BR:osa03400]
    4351671
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4351671
  RNA polymerase III system
   RNA polymerase III
     4351671
  RNA polymerase I system
   RNA polymerase I
     4351671
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4351671
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 4351671
NCBI-ProteinID: XP_015618232
UniProt: Q0IPN4
LinkDB
Position
12:4051743..4054432
AA seq 72 aa
MIIPVRCFTCGKVIGNKWDLYLDLLQADYTEGDALDALGLVRYCCRRMLMTHVDLIEKLL
NYNTLEKTETAG
NT seq 219 nt   +upstreamnt  +downstreamnt
atgatcatcccggtgcggtgcttcacctgcgggaaggtgattgggaacaagtgggatctg
tacctggatctcctccaggctgactacacagagggggatgctctggatgcattgggtttg
gtccgttactgctgccggcgaatgctcatgacccatgttgacctcatcgagaagttactc
aactacaacacgctggagaagaccgagacagcaggttaa

DBGET integrated database retrieval system