KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350084
Entry
4350084           CDS       T01015                                 
Name
(RefSeq) glucuronokinase 1
  KO
K16190  glucuronokinase [EC:2.7.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4350084
   00053 Ascorbate and aldarate metabolism
    4350084
   00520 Amino sugar and nucleotide sugar metabolism
    4350084
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.43  glucuronokinase
     4350084
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 4350084
NCBI-ProteinID: XP_015617202
UniProt: A0A8J8Y2V0 Q2R8T7
LinkDB
Position
11:6109402..6113732
AA seq 353 aa
MTEQEHRAYARVGLLGNPSDMYGGKTLSFTISNFWATVHLAPSDDGGPLVIRPHPRHDLV
DFASLPQLVTRLQNEGYNGGVRLLMAICKVFYSHCIQHGIALKEQNFTLSYDTNIPRQAG
LSGSSAIICAALSCLLDFYNVRHLIKVEIRPNIILDAEKELGIVAGLQDRVAQVYGGLVY
MDFGKEHMDTLGHGVYTPLDINLLPPLHLIYADNPSDSGKVHSTVRQRWLDGEEFIISSM
EEVARLALDGRKALLDKNYRELARLMNRNFDLRRQMFGDDVIGTVNIKMVEAARSVGAAA
KFTGSGGAVVALCPDGEAQVLLLEKACRDAGFLVQRIQVAPSPLPLTEGNPPF
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgacggagcaggagcaccgtgcgtatgcacgcgtcgggctcctcggcaatccgagcgac
atgtatggcggcaagacgctctccttcaccatttccaacttctgggccactgtccatcta
gctccatccgacgatggtggcccccttgtgatccggccgcacccacgacacgatctcgtc
gattttgcgtccctcccacaacttgtgactcgcttgcaaaatgaaggatataatgggggt
gttcggctgctcatggccatctgtaaagttttctatagccactgtatccaacatggtatc
gcactaaaggagcaaaatttcaccttatcatatgatactaatattcctcggcaggctggg
ctttctggttcaagcgctattatttgtgccgctctaagctgccttcttgatttttacaac
gtcagacatttaataaaagtcgaaatcagacctaatattattcttgatgccgagaaagag
cttggaattgttgctggtcttcaggatcgggtggcacaggtttatggtgggctagtctat
atggattttggcaaggagcatatggacacattgggtcatggcgtgtacacacctttggat
atcaatcttctccctcctctacatctgatctatgcagataatccgagtgattctggcaag
gtccacagcaccgttagacaaagatggcttgatggagaggagtttataatatcatctatg
gaagaagtagcgcggctggcccttgatggccgcaaggctctgttggacaagaattatagg
gagctcgcgaggcttatgaacaggaacttcgacctgcggaggcaaatgtttggagacgat
gtgattggtacggtgaacataaagatggtggaggctgcgaggagcgtgggcgcggccgcc
aagttcaccggcagcgggggcgcggtggtggccctgtgcccggacggcgaagcgcaggtg
ctgctcctggagaaggcgtgccgggatgctggctttcttgtgcagcgaatccaagtcgcg
ccatcaccgctaccgctcacggagggtaatcctcctttctaa

DBGET integrated database retrieval system