KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350176
Entry
4350176           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein CP26, chloroplastic
  KO
K08916  light-harvesting complex II chlorophyll a/b binding protein 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4350176
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4350176
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4350176
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4350176
NCBI-ProteinID: XP_015617156
UniProt: A3CA44 Q53N83 A0A1L2JKK6
LinkDB
Position
11:7659665..7662183
AA seq 283 aa
MAALAPSKMLGTRLNFAGSSRYATAAPTTGAQKIVSLFSKKPAPKPKPAAVTSSSPDIGD
ELAKWYGPDRRIFLPEGLLDRSEVPDYLNGEVPGDYGYDPFGLSKKPEDFSKYQAYELIH
ARWAMLGAAGFIIPEACNKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINLIVAVAA
EVVLVGGAEYYRIINGLDLEDKLHPGGPFDPLGLASDPDQAALLKVKEIKNGRLAMFSML
GFFIQAYVTGEGPVENLSKHLSDPFGNNLLTVISGAAERTPSL
NT seq 852 nt   +upstreamnt  +downstreamnt
atggcggcgctcgccccgtccaagatgctcggcacccggctcaacttcgccggctcctcc
cgctacgccaccgcggcaccgaccaccggagcgcagaagatcgtctccctcttcagcaag
aagcccgccccgaagcccaagcccgccgccgtcacctcctcgagccccgacatcggcgat
gagctcgccaagtggtacggccctgacaggaggatcttcttgccggagggtctcctggac
cgctcagaggtgccggactacctcaacggagaggtccccggagactacggctacgaccct
tttggcctcagcaagaagccagaggacttctccaagtaccaggcctatgagctgatccat
gccaggtgggcgatgctcggcgccgctgggttcatcatccccgaggcctgcaacaagttt
ggcgcaaactgcggccccgaggccgtctggttcaagaccggcgccctcctcctggacggc
aacaccctcaactacttcggcaacagcatccccatcaacctcatcgtcgccgtcgccgcc
gaggtcgtcctcgtcggcggcgccgagtactaccggatcatcaacggcctggatctggag
gacaagctccacccaggtggcccattcgacccgctggggctggcgagcgacccggaccag
gcggcgctgctgaaggtgaaggagatcaagaacgggcggctggccatgttctccatgctg
gggttcttcatccaggcctacgtcaccggcgagggccccgtcgagaacctctccaagcac
ctcagcgaccccttcggcaacaacctgctcaccgtcatctccggcgccgccgagaggacg
cccagcctgtaa

DBGET integrated database retrieval system