KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350355
Entry
4350355           CDS       T01015                                 
Name
(RefSeq) exosome complex component RRP43
  KO
K12586  exosome complex component RRP43
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4350355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4350355
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4350355
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 4350355
NCBI-ProteinID: XP_015615395
UniProt: B7ELW5 A0A8J8XTE4
LinkDB
Position
11:11980461..11987976
AA seq 306 aa
MAAEAQATAAGGLAGEMEVEAYRRLFPLAFLERHLRESVRPDARRPAEARPTTVALAAVS
SAHGSALVRLGDTAMLASIKLEVMSPSGEAPDEGSIAVEFHMPPICSPLVRPGRPAEVAP
VISKNLEDILMSSGMLNLKELCLISGKASWLAYLDVYCLNADGSLFDAALISAVAAFTHL
EIPLVSVGDDGRVFTVGGNEGKAKYELVNREKRKLTITNVPFSLTCALHKDNVLADPTAE
EESIIETSVTIVLDSSDQIVSIQKPGGAVTSMTTIKECISLAKDRRRKLREILMDNVEAM
EVDQTD
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcggcggaggcccaagccacggcggccggcggcctcgccggcgagatggaggtggag
gcgtaccgccgcctcttccccctcgccttcctcgagcgccacctccgcgaatccgtccgc
cccgacgcgcgccgccccgccgaggcccgcccaaccaccgtcgccctcgccgccgtgtcc
tccgcccacggctccgccctcgtccgcctcggcgacaccgccatgctcgcgtcgatcaag
ctcgaggtgatgtcgccctccggtgaggcccccgacgaaggatctattgctgtggagttc
cacatgccgcctatctgttccccgcttgtcagaccaggacggccggcagaggtggcgcca
gtcatctccaagaacctagaggacattctcatgagctcagggatgctaaatttgaaggag
ctctgtttgatcagtgggaaggcatcttggttagcatacctggatgtctattgtttgaat
gctgatgggtctctattcgacgctgcactaatctcagctgttgctgcatttacacatttg
gaaattcctttggtatctgtcggtgatgatggtagagtatttactgttgggggcaatgaa
ggcaaagccaaatatgaattggtaaacagagaaaagaggaagcttacgattactaatgtt
ccattttcccttacatgtgcacttcacaaggataatgttctagcggatccaactgctgaa
gaagaatcaataatagagacttctgtgactattgttctcgattcttcagaccagatagtg
tcaatacaaaaacctggaggtgcagtgacatctatgacaactattaaggaatgcattagc
ttggctaaggacaggagaagaaagttaagagaaattctcatggacaatgttgaagcaatg
gaagtcgaccaaactgattaa

DBGET integrated database retrieval system