KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350698
Entry
4350698           CDS       T01015                                 
Name
(RefSeq) adagio-like protein 3 isoform X1
  KO
K12116  flavin-binding kelch repeat F-box protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4350698
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4350698
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     4350698
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_2 Kelch_1 Kelch_5 Kelch_6 PAS_9 PAS PAS_3 F-box PAS_4 F-box-like PAS_8
Other DBs
NCBI-GeneID: 4350698
NCBI-ProteinID: XP_015617056
UniProt: Q2R2W1
LinkDB
Position
11:complement(20182489..20187353)
AA seq 630 aa
MFDAGDRGGGGGVVAVKRMKLCEEEEEEEEGMEVDEEEEEVGWVWRPPGGLAGEDEAAAW
EGRAAAIVVSDAVEVDFPVIYVNAAFEAATGYRADEVLGRNCRFLQFRDPRAQRRHPLVD
PMVVSEIRRCLNEGIEFQGELLNFRKDGAPLYNRLRLIPMHGDDGFVTHVIGIQLFSEAN
IDLSNVSYPVYKQQSNHRPNIQEINPASHEHIPKIQSSEYCCILQLSDEVLAHNILSRLS
PRDVASIGSVCTRMHELTKNDHLRKMVCQNAWGRDVTVRLEMSTKMLGWGRLARELTTLE
AASWRKFTVGGRVEPSRCNFSACAVGNRLVLFGGEGVNMQPMDDTFVLNLESAKPEWRRV
KVSASPPGRWGHTLSWLNGSWLVVFGGCGQQGLLNDVFVLDLDAKQPTWREVASEGPPLP
RSWHSSCTLDGSKLVVSGGCTESGVLLSDTFLLDLTKEKPAWKEIPTSWSPPSRLGHTLS
VFGKTKLFMFGGLAKSGSLRLRSCDAYTMDAGEDSPQWRQLATTGFPSIGPPPRLDHVAV
SLPCGRIIIFGGSIAGLHSPSQLFLLDPAEEKPTWRILNVPGQPPKFAWGHSTCVVGGTR
VLVLGGHTGEEWILNELHELCLASRPDEDE
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgtttgatgcgggggatcgcggcggaggcggcggggtggtggcggtgaagaggatgaag
ctgtgcgaggaggaggaggaggaggaggaggggatggaggtggatgaggaggaggaggag
gtggggtgggtgtggaggccgccgggggggctagcgggggaggatgaggcggcggcgtgg
gaggggagggcggcggcgatcgtggtgtcggacgcggtggaggtggatttcccggtcatc
tacgtcaacgccgccttcgaggccgccacggggtaccgcgccgacgaggtcctcggccgc
aactgccgattcttacaattccgggatccacgtgcccaaagacgacatccgcttgttgat
cccatggttgtttcagagatccggcgatgcttgaatgagggaattgagttccaaggtgag
ctattgaattttcggaaggacggtgctccactgtacaacaggctaaggctcattccaatg
catggggatgatggttttgtgactcacgtcattggaatccagttgttctctgaagctaac
attgatcttagcaatgtatcatatccagtgtataaacaacagtccaaccacagacccaac
attcaagagatcaaccctgcttctcatgaacatattcctaagattcaaagttccgagtac
tgctgcatcctccagctctcagatgaagttctggcgcacaacatattgtctcgcttatcg
ccaagagatgttgcatccatcggatcagtctgcactagaatgcatgagttgaccaagaat
gatcacctgagaaagatggtatgtcaaaacgcgtggggaagagacgtcactgtgaggctt
gagatgagcaccaagatgttaggatggggtcgtcttgcaagagagcttacaacccttgag
gcagcttcatggaggaagtttacagttggaggtcgtgttgagccttcccgttgcaacttc
agtgcctgtgctgttggtaatcgccttgtcctgtttggaggtgaaggagtcaacatgcag
ccaatggatgatacctttgtgctcaacctggaatctgcaaagcctgaatggcgccgtgtc
aaagtttcagcttctccacccggccggtgggggcacactctctcatggctgaatggctca
tggctagtggtctttggaggctgtggacagcaaggtttgctcaatgatgtctttgtcctt
gaccttgatgccaagcagcccacctggagggaggttgcaagcgagggcccaccattgccg
aggtcatggcacagttcatgtaccctggatggatcaaagcttgttgtctcaggggggtgc
actgaatccggtgtgctcctcagtgacacattcctgcttgacctcaccaaggaaaaacca
gcatggaaggagatcccaacatcctggtcaccaccatcccgcctcggccacaccttgtcc
gtctttggtaagaccaaactcttcatgtttggtgggttggcaaagagcggctctctccgg
ctacgctcctgtgatgcctacactatggacgctggtgaagacagcccacaatggaggcaa
ctggcgacaaccgggttcccgagcatcggtccacctccgaggctcgatcatgtcgcggtc
agcctcccctgtggacggataatcatattcggtggctccatcgctgggctgcactcgccc
tcacagctgttcctcctcgacccagcggaggagaagccgacatggaggattttgaacgtc
cctggccagccacccaagttcgcctggggtcatagcacatgcgtggttggcggcaccagg
gttcttgtcctgggtggccacactggggaggagtggattctcaatgagctccatgagctg
tgcctcgcgagcaggcccgacgaagatgagtga

DBGET integrated database retrieval system