KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350754
Entry
4350754           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 1
  KO
K10754  replication factor C subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4350754
   03420 Nucleotide excision repair
    4350754
   03430 Mismatch repair
    4350754
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4350754
   03400 DNA repair and recombination proteins [BR:osa03400]
    4350754
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4350754
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4350754
SSDB
Motif
Pfam: RFC1 BRCT AAA Rad17 AAA_30 AAA_22 DNA_pol3_delta PTCB-BRCT RuvB_N AAA_16 AAA_5 AAA_assoc_2 Sigma54_activ_2 BRCT_2 Zeta_toxin AAA_24 AAA_17 RNA_helicase AAA_18 GREB1_C RsgA_GTPase NTPase_1 AAA_33 AAA_14 Mg_chelatase TsaE AAA_19
Other DBs
NCBI-GeneID: 4350754
NCBI-ProteinID: XP_015617630
UniProt: Q2R2B4
LinkDB
Position
11:21443057..21452911
AA seq 1021 aa
MSSDIRKWFMKAQDKNGGAAKPAGTTALAKKPVLSIPEKPSAAPSMAACDQDCSARRKTS
KYFASKTEKEEDTSAGKGTGRGLPKRKLQKVSDELEDDMKPLPAKEVHKEEEDDDDDDFV
APSKRKTPVKPPPSKKLKGASTAEAHGKTGLDDDNEDKMDEDAKTPSKASGSGRGRGRGR
GRGGRGAGAAHGKTIGLDDDGEEDKMDEDAKTPSKAAGRGRGGASGGRGRGGGGRGFMNF
GERKDPPHKGEKEVPEGAPDCLTGLTFVISGTLDSLEREEATDLIKRYGGRVTGSISKKT
NYLLADEDVGGVKSNKAKELGVPFLTEDGLFDMIRKSKPAKATVAKHQSDKNSEKQQKSP
MKSSPVKVERRDGNQITTGKNISPKSNKGSASIDNQKVNIVDRGSLQWTEKYRPKVPNDI
VGNQSMVKQLHDWLRSWEDQFLHSGQKGKGKKQADSGAKKAVLLSGPPGIGKTTTAKVVS
QMLGLQAIEVNASDSRGKADSKIEKGVGGSTSNSIKELISNATLNYSNNRLKRPKAVLVM
DEVDGMSAGDRGGVADLIASIKMSKIPIICICNDRYSQKLKSLVNYCLLLNFRKPTKQQM
GKRLMEIAKKEGLQAQENAMEELAERVHGDIRMALNHLQYMSLSQSVVKYDDIRQRLNSS
TKDEDISPFTAVDKLFGFNGGRLRMDERIDLSMSDPDLVPLIIQENYINYRPITVGKDDS
GVKRMNFLARAAESIADADIVNVQIRRYRQWQLSQAACLSSSIVPAALMHGNREILEAGE
RNFNRFGGWLGKYSTTNKNIRLLEDAHSHILASQQANLDRESLRLDYLTLLLRQLTDPLK
TMPKDEAVQKVVEFMDTYSLSQEDFDTIVELSKFKGHPNPMDGIQPAVKSALTKAYKQGS
SSRVVRAADLVNIPGMKKPLKKRVAAILEPVGESLPEENGVASSEGDEEDSSDAENNDEL
VPGDTKPKLDLQSDKKKGIQVQLDLKSNGNGLNSKKMPAGRSKASGSAGKAAGGSGGKRK
R
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgtcttcggacatcaggaaatggttcatgaaggcgcaggacaagaatggtggcgcagcg
aagccggctgggacgacggcgttggcgaagaagcccgtgctcagcattccggagaagccg
tcggcggcgccatctatggcggcttgtgatcaagattgttcagctagaaggaagactagc
aagtactttgcatccaaaacagaaaaggaggaagacaccagtgcaggaaaaggtaccggg
agaggtttgcctaaaagaaaacttcagaaagtcagtgatgagcttgaggatgacatgaag
cctttgccagcaaaggaagtccataaagaagaagaagatgatgatgacgacgactttgtg
gcaccttcaaaaaggaaaactccggtgaagccaccaccatcaaagaagttgaagggtgca
tctactgctgaagctcatggaaagactggtcttgatgatgataacgaggacaagatggat
gaagacgctaagaccccttccaaggcatctggaagtggaaggggaaggggaagggggaga
gggaggggaggaagaggagcaggagcagcccatggaaagacaattggtcttgatgacgac
ggtgaggaggataagatggatgaagatgccaagaccccttccaaagcagctggaagggga
aggggaggagcctctgggggaagagggagaggagggggtgggagaggcttcatgaacttt
ggtgaaaggaaggatcctcctcacaaaggggagaaggaagtcccggagggtgcccctgac
tgtttaactggtttgacatttgtcataagtggcactcttgacagtcttgaacgtgaggag
gcaactgatctaatcaagcgttatggaggccgtgtgaccggctctattagcaaaaagacg
aattacctattggctgatgaagacgttggtggagtgaaatcaaataaagcgaaagaactg
ggcgtcccattcctaactgaagatggtttatttgatatgattcggaaatcaaagcctgca
aaggctactgtggcaaaacatcaaagcgacaaaaattcagaaaagcagcaaaaatcacca
atgaagagttctccagttaaagttgaaagaagagatggtaatcaaattaccacaggcaaa
aatatttcaccaaagagtaataaaggaagtgcctccattgacaaccaaaaggtcaacatt
gttgaccgtggttctttgcaatggactgaaaagtatcggcccaaagttccaaatgacata
gttgggaaccaatcaatggttaaacagcttcatgattggttgagaagttgggaggaccaa
ttccttcattctggccagaagggtaagggaaagaagcaggctgatagtggagctaaaaag
gctgtgttgttgagtggacctccaggtattggtaagaccacaactgctaaagttgtcagt
cagatgcttggattgcaggctattgaggttaatgcaagtgatagccgtggtaaggcagac
tctaagattgagaaaggtgttgggggcagtacatcaaattctatcaaagagcttattagt
aatgcaactctgaattatagtaacaaccgattaaaacgacccaaggctgtactagtcatg
gatgaagttgatggtatgtctgctggagatcgtggtggtgttgctgatcttattgctagc
attaagatgtccaagattcctataatttgcatttgcaatgaccgttatagccagaaattg
aagagccttgtaaattactgcttgctactcaacttcagaaaaccaaccaagcaacagatg
ggtaagaggttgatggaaattgccaagaaggaaggtcttcaagctcaagagaatgcaatg
gaagaacttgcagaaagagtacacggggatattcgcatggctcttaaccatttgcaatat
atgagcctctcccagtccgtggtcaaatatgatgatataagacagcgacttaatagtagc
acaaaagatgaagatatttcccccttcacggctgttgacaagctgtttggttttaatggt
gggagactacggatggatgagagaattgatttgagcatgagcgatcctgatttagtccct
ctgattatccaggaaaactatatcaattatcggcctatcactgttgggaaggatgacagt
ggagttaaaagaatgaattttcttgctcgtgctgctgaatctatagcggacgctgatatt
gttaatgtacaaataagaagatatcgacagtggcaattgtcccaagctgcttgtttgtct
tcatctatagttcctgctgctttgatgcatgggaatagagagatccttgaagcaggtgag
cgaaacttcaataggtttggtggatggttgggaaagtactcgaccacaaataaaaacata
aggctactggaagatgcccatagtcatattcttgcctcccagcaagcaaatttggacagg
gagtcattgaggctggattacctcactcttctcttgagacaattgactgatccactgaag
acaatgcccaaggatgaagctgtgcaaaaagtggtggagtttatggatacctactcttta
agccaggaagactttgacacaattgttgaattatcaaaatttaagggtcatccaaatcct
atggatggtattcaaccagctgttaaaagtgccttaacaaaagcatacaaacaaggaagt
agttctcgtgttgttcgagcagcagatctagtaaatatcccaggcatgaaaaagccatta
aagaaacgagtggcagcaatccttgagccagtgggagagagtttgcctgaagaaaatgga
gtagcgtcatctgaaggcgatgaagaggattcctctgatgctgaaaataatgatgaactg
gtgcctggtgacacaaaaccaaaactggacctgcagagtgataagaagaaagggatccaa
gtgcagctcgacctgaagagcaatggcaatggcttgaactcgaagaagatgccggctggt
agatcaaaagcttctggctctgctgggaaggctgctggaggctcaggtgggaagaggaag
aggtaa

DBGET integrated database retrieval system