KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350922
Entry
4350922           CDS       T01015                                 
Name
(RefSeq) proteasome subunit alpha type-5
  KO
K02729  20S proteasome subunit alpha 5 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4350922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4350922
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4350922
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4350922
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4350922
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    4350922
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 4350922
NCBI-ProteinID: XP_015617773
UniProt: Q9LSU1
LinkDB
Position
11:complement(23938259..23942543)
AA seq 237 aa
MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGLKTKDGVVLAVEKRVTSPLLE
PSSVEKIMEIDEHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQAICDLA
LRFGEGDEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQ
EQYNKELTLQEAETIALSILKQVMEEKVTPNNVDIAKVSPNYHLYTPAEVEAVIARL
NT seq 714 nt   +upstreamnt  +downstreamnt
atgttcctcacgaggacggagtacgaccgcggggtgaacaccttctccccggaggggcgg
ttgttccaggtcgagtacgccattgaggccatcaagttggggtcaactgcgatcgggttg
aagaccaaggatggtgttgtccttgctgtagagaaacgtgtgacctcgccactgctggaa
ccaagcagtgtggagaaaatcatggaaattgacgagcacataggctgtgccatgagtggc
cttattgctgatgctagaacattggttgagcatgctcgtgttgaaacccagaatcatagg
ttctcatatggggagccaatgacagtagaatctactacacaagctatctgtgacttagct
ctgcgttttggtgaaggtgatgaagagtcgatgtcacgaccatttggtgtctctctcctt
attgctggtcatgatgagaatggacccagcttgtactacactgacccatcaggaaccttt
tggcagtgcaatgccaaggcaattggatcaggttctgaaggagctgatagctcattacag
gagcagtacaataaggagttgacccttcaggaggctgagaccatagccctgtctatcttg
aagcaggttatggaagaaaaggttactccaaacaacgtcgatatcgcaaaggtttctccc
aactaccacctctacacccctgcagaggttgaagctgtcattgcacggttgtga

DBGET integrated database retrieval system