KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350939
Entry
4350939           CDS       T01015                                 
Name
(RefSeq) mitochondrial inner membrane protease subunit 1 isoform X1
  KO
K09647  mitochondrial inner membrane protease subunit 1 [EC:3.4.21.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4350939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4350939
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4350939
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     4350939
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   4350939
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    4350939
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-GeneID: 4350939
NCBI-ProteinID: XP_015615338
LinkDB
Position
11:complement(24165772..24169634)
AA seq 190 aa
MSGFARRLGGIPWREIAGEAFSRVFLVAQAVCAVHVVNAHVCSFALVMGPSMLPAMNLAG
DVVAVDLVSARLGRVASGDAVLLVSPENPRKAVVKRVVGMEGDAVTFLVDPGNSDASKTV
VVPKGHVWVQGDNIYASRDSRQFGPVPYGLITGKIFCRIKQQDWQPSHIKSRSTGQLSRN
SKQASMRPSQ
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtccgggttcgcgcggcgcctcggcgggatcccgtggagggagatcgccggggaagcc
ttctcccgcgtcttcctcgtcgcgcaggccgtctgcgccgtccacgtcgtcaacgcccac
gtctgctccttcgcgctggtgatgggcccgagcatgctgccggcgatgaacctggcgggg
gacgtggtggcggtggacctggtgagcgcgcggctcgggcgggtggcgagcggcgacgcc
gtgctcctcgtctcgccggagaacccgcgcaaggcggtcgtcaagcgcgtcgtcgggatg
gagggcgacgccgtcacgttcctcgtcgaccccggcaacagcgacgcctccaagaccgtc
gtggtaccaaaaggccatgtctgggtgcagggtgataatatttatgcttctagagattca
agacagtttggacctgtcccttatggtctaattacagggaagatcttttgtcggatcaaa
cagcaagattggcagccatctcacatcaaatccagatcaacaggacagctctcaaggaat
tccaagcaagcctccatgaggccatcacagtga

DBGET integrated database retrieval system