KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351059
Entry
4351059           CDS       T01015                                 
Name
(RefSeq) WD repeat-containing protein VIP3
  KO
K12602  WD repeat-containing protein 61
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4351059
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4351059
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     4351059
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 eIF2A Ge1_WD40 Nup160 WD40_like Cytochrom_D1 DUF5711
Other DBs
NCBI-GeneID: 4351059
NCBI-ProteinID: XP_015617388
UniProt: Q2R037 Q0IR99
LinkDB
Position
11:26501623..26504316
AA seq 323 aa
MKLAGLKSVDGAHEESIWAAAWVPAADHRPAALLLTGALDETVRLWAPDDLASAAASPSR
GHALGVVSLAAHPAGAVAAAVSLDSYVRVFDVDSGSSVATLEAPPSEVWGIQFHPKGSAL
AAAGGGSGSVKLWDTEKWKPITSLAVPRPEGARPDKTGSGKFVLSVAWSPDGKLLACGSM
DGTIAVYDAVRMKFLHHLEGHHMPVRSMVFSPVDPHVLFTASDDCHIHIYDAKEKSLIGA
MSGHASWVLSIDVSPDGMAVATGSSDRTVRLWDINTRASVQTMSNHNDQVWAVAFRPPGG
TGVRAGRLASVSDDKSITLYDYS
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaagctcgcggggctcaagtcggtggacggggcccacgaggagtccatctgggcggcg
gcgtgggtgcccgcggcggaccaccgccccgcggcgctgctcctgacgggcgccctcgac
gagaccgtccgcctctgggcccccgacgacctcgcctccgccgccgcctccccctcgcgg
ggccacgcgctcggggtggtgtcgctcgccgcccaccccgcgggcgccgtcgccgccgcc
gtctccctcgacagctacgtccgcgtcttcgatgtggactcgggctcctccgtcgccacg
ctcgaggcccctccctccgaggtctggggcatccagttccaccccaagggtagtgctctg
gctgcagctggtggtggcagtggatcagtgaagctctgggacacagagaagtggaagcca
attaccagccttgctgttccgcgtccagagggagctcgccctgataaaacaggaagcggc
aagtttgtcctttcagttgcatggagtcctgatggcaagctcttagcttgtggttccatg
gatggcaccatcgctgtgtatgacgcagttcgcatgaagttcctccaccaccttgagggc
catcacatgccagtgagatcaatggtgttctctccagtggacccgcacgtgctcttcact
gcctccgacgattgccacatccacatatacgacgccaaggagaagagcctcattggggcc
atgtcagggcatgcgagctgggtgctgagcatcgacgtgagcccagacggcatggcggta
gcgacaggctccagtgaccgcacggtccggctttgggacatcaacacgagggcgtcggtg
cagacgatgagcaaccacaatgatcaggtctgggctgtcgccttccgaccaccgggtggg
acaggagtccgcgcaggccggcttgccagcgtgtcagatgacaagagcatcaccctgtac
gattactcatag

DBGET integrated database retrieval system