KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351227
Entry
4351227           CDS       T01015                                 
Name
(RefSeq) transcription elongation factor B polypeptide 1
  KO
K03872  elongin-C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4351227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4351227
   03400 DNA repair and recombination proteins [BR:osa03400]
    4351227
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Adoptor protein
     4351227
   Cul5 complex
     4351227
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     4351227
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 4351227
NCBI-ProteinID: XP_015616795
UniProt: B9G8W9 Q53NW5
LinkDB
Position
11:complement(28957909..28961092)
AA seq 124 aa
MLRKGEAPGHQTPPHLHKDDGDDDDDAPSGFVKLISAEGFEFVVDKKAAMVSNTLRNMLT
SPGGFSETREGEVRFPEISTPILEKICQYFYWSLHYSSGKETSEFQIEPEITLELMMAAN
YLDT
NT seq 375 nt   +upstreamnt  +downstreamnt
atgctgcggaagggagaggcgccggggcaccaaaccccaccccacctgcacaaggacgac
ggcgacgacgacgacgacgcaccgtccggcttcgtcaagctcatcagcgccgagggcttc
gagttcgtcgtcgacaagaaggccgccatggtctccaacacgctccgcaacatgctcacc
tcccccggcggcttctccgagacgcgcgagggcgaggttaggttccccgagatcagcacc
cccatcctcgagaagatctgccagtacttctactggtcgctccactactccagtgggaag
gagacatctgagtttcaaattgaaccggagataactctggagctgatgatggctgcaaac
tatctggacacctga

DBGET integrated database retrieval system