KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351626
Entry
4351626           CDS       T01015                                 
Name
(RefSeq) alpha-(1,4)-fucosyltransferase
  KO
K14412  alpha-1,4-fucosyltransferase [EC:2.4.1.65]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4351626
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4351626
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.65  3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase
     4351626
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4351626
SSDB
Motif
Pfam: Glyco_transf_10 K_channel_TID
Other DBs
NCBI-GeneID: 4351626
NCBI-ProteinID: XP_015618206
UniProt: Q2QX39 A0A8J8XER7
LinkDB
Position
12:3583415..3587359
AA seq 423 aa
MLFPKRINYMAPMLASAVILLLLVSGYFELPSISSYSAAPAPPLFATALDAVGTRERSPF
TSLLSAFADWDAAVGCPRIRAKLDAVGAPGYGANSTAAAAASITGGAGWGGGGGGRCEGV
RTRHVGVLVKGWTWIPDALDGVYTCRCGVSCVWSKSAAAVDRPDALLFEGATPPPQRMKG
LPLRVYLDLEAARKPTGFEDIFIGYHAKDDVQVTYAGKSFHTSRSYHVSTEKRNDALIYW
SSSRCLPHRDKVAKDFLSLVPHHSFGKCLNNVDGPDMALSMYPVCSTNDNGKPHWWDHLH
CAMSHYKFVLAIENTKTESYVTEKLFYALEAGSVPIYFGAPNVWDFIPPNSIIDASKFSS
LRELASYVKAVANDPVAYAEYHAWRRCGTLGNFGRSREMSLDTLPCRLCELVSKRGGRNA
DAL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgctcttcccgaagcggatcaactacatggccccgatgctggcctccgccgtcatcctc
ctcctcctcgtctccggctacttcgagctcccgtccatctcctcctactccgccgcgccg
gcgccgccgctcttcgccacggcgctggacgccgtcggcacccgcgagcggtcgccgttc
acgtcgcttctctcggccttcgccgactgggacgccgccgtcgggtgcccgcgcatccgc
gccaagctcgacgccgtgggggcgcccgggtacggcgccaactcgaccgcggcggcggcc
gcgtcgatcaccggcggggccgggtggggcggcggcggcggcgggaggtgcgagggcgtg
aggacgcgccacgtcggggtgctcgtcaaggggtggacgtggatccccgacgcgctcgac
ggggtgtacacgtgccggtgcggggtgagctgcgtgtggagcaagtccgccgccgccgtc
gaccggcccgacgcgctgctcttcgagggcgccacgccgccgccgcagagaatgaaaggc
ctgcctcttcgtgtatatctggatctggaggctgctaggaaaccaactggtttcgaggac
atttttataggttaccatgctaaagatgatgtgcaagtaacatatgctggaaaatcattc
cacactagccgaagttaccatgtatcaactgaaaagagaaatgatgcacttatttactgg
tcatcttcaaggtgtcttcctcatagagacaaggttgcaaaagatttcctgtcattggtt
ccgcaccactctttcgggaaatgcttgaataatgttgatggtcctgacatggcattatcc
atgtatccagtttgttcaaccaatgataatggaaaaccacactggtgggatcatcttcac
tgcgcaatgtcacattacaagtttgttcttgcaattgagaatactaagacagaaagctat
gtgaccgagaaattgttctatgccttggaggctgggtcagtgccaatatacttcggggca
cccaatgtctgggacttcattcctcccaattctattatagatgcctcaaaattcagctca
ctccgtgagttggcatcatatgtgaaagctgttgcaaatgatcccgtagcctatgcagaa
taccatgcatggaggaggtgtggtaccctgggtaactttggaaggtcgcgtgaaatgagc
cttgacacactgccttgccgactttgtgaactagttagtaagagaggtggtagaaatgca
gatgcattgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270041
Entry
9270041           CDS       T01015                                 
Name
(RefSeq) alpha-(1,4)-fucosyltransferase
  KO
K14412  alpha-1,4-fucosyltransferase [EC:2.4.1.65]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    9270041
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    9270041
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.65  3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase
     9270041
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   9270041
SSDB
Motif
Pfam: Glyco_transf_10
Other DBs
NCBI-GeneID: 9270041
NCBI-ProteinID: XP_015636405
UniProt: Q7XQP0 A0A8J8YK30
LinkDB
Position
4:21447786..21449652
AA seq 456 aa
MSSPPSSGSERSLASLVSAAAHSVKLNRAYLLAPAVAAGLLAAVLLSSLLDFSAFSASPR
PAFPPPTAGAPANASALSAPPRAPVRTALDTLGTRPREPFTALRDAYARWDAAVGCAAFA
EKHRSRSSPPPGPAALQDPEAAPCGSLRLPHVALAVRGVTWVPDILDGVYQCRCGLTCLW
SRNEEALADTPDVVLYEIWPPPDTRKQGEPLRAFMDIEPTRKRSGHEDIFIGYHADDDVQ
VTYAGKFFRITHNYHVATHKRDDVLVYWSSSRCFEHRNKIARELFRHLPAHSFGRCENNV
GGGDKALELYPDCARDGHGAAEWWDHLHCAMSHYKFVLAIENTIADSYSTEKLYYALEAG
SVPIYFGAPNARDLAPPGSYIDGAAFASAEELAAYVREVAGDPAAYAEFHAWRRCGVLGG
YGRNRLVSLDTLPCRLCERASRMGGRHAPAPNATVS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtcgtcgccgccgtcctcgggctcggagcgctcgctggcgtcgctcgtctccgcggcg
gcgcactccgtcaagctcaaccgcgcctacctcctcgccccggccgtcgccgcgggcctc
ctcgccgccgtgctcctctcctccctcctcgacttctccgctttctccgcctccccgcgg
ccggcgttccctccgccgaccgcgggcgcgccggcgaacgcgtcggccctgtcagcgccg
cctcgcgcgcccgtgcgcacggccctggacacgctcgggacgcggccgcgggagccgttc
acggcgctgcgcgacgcgtacgcgcggtgggacgcggcggtggggtgcgcggccttcgcg
gagaagcaccggtcgcggtcgtcgccgccgcccggcccggcggcgctgcaggaccccgag
gcggcgccgtgcggctcgctgcggctgccccacgtcgcgctcgccgtgaggggggtgacg
tgggtgcccgacatcctcgacggcgtgtaccagtgccggtgcgggctgacctgcctctgg
agccgcaacgaggaggccctcgccgacacccccgacgtcgtgctctacgagatctggccc
cctcccgacaccaggaagcagggcgagccgctgcgcgcgttcatggacatcgagccgacg
aggaagcggtcggggcacgaggacattttcatcggctaccacgccgacgacgacgtgcag
gtgacctacgccggcaagttcttccgcatcacccacaactaccacgtcgccacccacaag
cgcgacgacgtgctggtgtactggtcgtcgtcgcggtgcttcgagcaccggaacaagatc
gcgcgggagctgttccgccacctcccggcgcactccttcggccggtgcgagaacaacgtc
ggcggcggcgacaaggccctggagctgtacccggactgcgcccgcgacggccacggcgcg
gcggagtggtgggaccacctccactgcgccatgtcgcactacaagttcgtgctcgccatc
gagaacaccatcgccgacagctactccacggagaagctctactacgcgctggaggccggg
tcggtgcccatctacttcggcgcgcccaacgcccgcgacctggcgcccccgggctcctac
atcgacggcgccgcgttcgcgtcggcggaggagctcgcggcgtacgtgagggaggtggcc
ggcgacccggcggcgtacgccgagttccacgcgtggcggcggtgcggcgtcctgggcggc
tacggccggaaccggctcgtcagcctcgacacgctcccgtgcaggctctgcgagcgcgcc
agccgcatgggcggccgccacgcgccggcgcccaacgccaccgtgtcgtga

DBGET integrated database retrieval system