KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351654
Entry
4351654           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4351654
   03420 Nucleotide excision repair
    4351654
   03430 Mismatch repair
    4351654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4351654
   03036 Chromosome and associated proteins [BR:osa03036]
    4351654
   03400 DNA repair and recombination proteins [BR:osa03400]
    4351654
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4351654
  DNA Replication Termination Factors
   ELG1-RFC complex
    4351654
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4351654
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4351654
  Check point factors
   HRAD17(Rad24)-RFC complex
    4351654
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_22 Rad17 RuvB_N Mg_chelatase AAA_16 AAA_assoc_2 AAA_14 AAA_24 ResIII AAA_5 AAA_11 DNA_pol3_delta PhoH AAA_19 DUF2075 AAA_23 AAA_25 AAA_30 AAA_7 IstB_IS21 bpMoxR AAA_18 RNA_helicase AAA_28 DUF3853
Other DBs
NCBI-GeneID: 4351654
NCBI-ProteinID: XP_015618344
UniProt: Q9FXM3
LinkDB
Position
12:3873310..3877273
AA seq 339 aa
MAPLVPSSQPWVEKYRPRQVKDVAHQEEVVRVLTTTLQTADLPHMLFYGPPGTGKTTTAL
AIAYQLYGPELYKSRVLELNASDDRGINVVRTKIKDFAAVAVGSARKGGYPCPPYKIIIL
DEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSN
RILHICNEEGLSLDAQALATLSTISNGDLRRAITYLQSAARLFGSSISSTDLISVSGAIP
EDVVKSLLASCKSGEFDVANKEVNNIIADGYPVSQLISQFLDVIVNADDIPDEQKARICK
KLGEADKCLVDGADEYLQLLDVASETIRALFDMPQTLVF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcgccgctcgtgccgtcctcgcagccatgggtggagaaataccggccgaggcaggtg
aaggatgtcgcgcaccaggaggaggtggtccgggtgctcaccaccaccctccagaccgcc
gaccttccgcacatgctgttctacggcccgcctggcaccgggaagaccaccaccgcgctt
gccattgcttaccagctctacggtccagagctctacaagtcaagagttctagaacttaat
gctagtgatgatcgtggaattaatgtggtgaggactaagatcaaggactttgctgctgtt
gctgttggttctgcacgaaaaggcggttatccctgcccaccatacaagattattatacta
gatgaagcagattcgatgacagaagatgcccagaatgctttaaggcgtactatggagact
tactccaaagtgacaagattctttttcatatgcaattacatcagcaggataatagaacca
cttgcatcaagatgtgcaaagtttagattcaagcctctttcagaagaagtaatgagcaat
cgcattttgcatatatgcaatgaagaagggctcagtcttgatgctcaggcattggctaca
ctaagcaccatctctaatggtgacctccgccgtgctataacctatcttcagagcgctgct
cgcttatttggatcttctatttcttctactgacttgattagtgtttcaggggctatccct
gaagacgttgtcaagtcattgcttgcatcttgcaaatctggtgaatttgatgtggcaaac
aaggaagtcaataatattattgcagatggataccccgtttcacagttgatctcacagttt
ctagatgtgatagttaatgccgatgatattccagatgagcagaaggcaagaatatgtaaa
aagcttggggaagcagataagtgcttggtcgatggagcggatgagtatttacagcttttg
gatgtggctagtgagactatccgtgctctttttgacatgccacaaacgctggtcttctaa

DBGET integrated database retrieval system