KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351847
Entry
4351847           CDS       T01015                                 
Name
(RefSeq) argininosuccinate synthase, chloroplastic
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4351847
   00220 Arginine biosynthesis
    4351847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351847
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     4351847
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4351847
SSDB
Motif
Pfam: Arginosuc_synth QueC
Other DBs
NCBI-GeneID: 4351847
NCBI-ProteinID: XP_015620624
UniProt: A3CG54 Q2QVC1
LinkDB
Position
12:7430527..7434682
AA seq 481 aa
MAHALGCGAATAPAGVGLLHHHEKAGALFSAAGSIVRVQQLSGKGSKSQAIRCAMPSASE
HGGISTATASSSDQKKGGLRGKLNKVVLAYSGGLDTSVIVPWLRENYGCEVVCFTADVGQ
GDIELEGLEKKAKASGASQLVVKDLKEEFVSEYIYPCLRAGAVYERKYLLGTSMARPVIA
KAMVDVAKEVGADAVAHGCTGKGNDQVRFELTFYALNPELKVVAPWREWDITGREDAIEY
AKKHNVPIPVTKKSIYSRDRNLWHLSHEGDILEDPANEPKEDMYMMSVAPENAPSKPEYL
EIGIIAGVPVSINGKDLSPASLLAKLNEIGGKHGIGRIDMVENRLVGMKSRGVYETPGGT
IMAAAVRELESLTLDRETMQWKDMLALKYAELVYAGRWFDPLRQSIDAFMENITATTTGS
VTLKLYKGSVNVASRKSPYSLYREDISSFENGEIYNQADAEGFIRLYGLPTRVRAMLEKG
I
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcgcacgccctcggctgcggcgccgccaccgcccccgccggggtgggtctcctccac
caccacgagaaggctggggcgttgttcagtgccgcaggctccatcgttcgggttcagcag
ctcagcgggaaggggagcaaaagccaagctataagatgtgcaatgccaagtgcaagtgag
catggtggaatttcaaccgcaacagctagtagtagtgatcaaaagaaaggtggactgcgt
ggcaaactgaataaagttgttctagcttacagtggtggtttggatacatcagttattgtt
ccatggctccgggagaactatggttgtgaagttgtctgtttcactgctgatgttggccag
ggtgacattgaattggaagggctagagaagaaggcaaaagctagtggtgcaagccagctt
gttgtgaaggacttgaaagaagagttcgttagtgaatacatttacccctgcttgcgtgct
ggtgcagtttatgaaagaaagtatctgctggggacttcaatggctaggcctgttattgcc
aaggcaatggttgatgttgcaaaggaagttggtgcagatgcagttgctcatggatgcact
ggaaaaggcaatgatcaggttcgttttgagcttacattctatgctttaaaccctgagctt
aaagtggtggcaccttggagggagtgggatatcacaggacgtgaagatgctattgagtat
gcaaagaaacacaatgtgccaattcctgttacaaagaaatcaatatacagccgtgatcga
aatttgtggcaccttagccatgagggtgacattttggaagatccagcaaatgagccaaag
gaagatatgtatatgatgtcagttgcaccagaaaatgcaccttcaaaacctgagtatttg
gagattggtattattgcaggtgttcctgtttccatcaatggaaaagatctctcaccagca
tctctccttgccaagctcaatgaaatcggtggaaagcatggtattgggcgcattgatatg
gtggaaaaccgcctcgtaggcatgaagtcccgtggtgtatacgagacccccggtggcacc
atcatggcagctgctgtccgtgagctcgagtccttgactttggacagggagacaatgcag
tggaaggacatgcttgccctcaagtacgccgagctggtctacgctggccgttggttcgac
ccgctccgacaatccattgatgcgttcatggagaacattaccgcgacaacaaccggctcc
gtgactctcaagctgtacaagggctccgtaaacgtcgcgtcccggaagagcccatacagc
ctgtacagggaagacatctcctcatttgagaatggggagatctacaaccaggctgatgct
gaagggttcatcaggctatatggtctccctaccagagtccgggcaatgctggagaagggc
atctaa

DBGET integrated database retrieval system