KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352037
Entry
4352037           CDS       T01015                                 
Name
(RefSeq) exosome complex component RRP42
  KO
K12589  exosome complex component RRP42
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4352037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4352037
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4352037
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     4352037
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 4352037
NCBI-ProteinID: XP_015620528
UniProt: Q2QT85 A0A8J8YJV7
LinkDB
Position
12:12075092..12087734
AA seq 284 aa
MVGLSEGEKHFIRGGIAQDLRTDGRRRLQFRAISVETGVIPQANGSARVRLGATEVIATV
KAELGKPSILHPDKGKVSIFVDCSPTAAPMFEGRGSEEFSAELCVALQRCLLGGKSGAGA
AIDLSSLIVVDGKVCWDLYIDGLVVSSDGNLLDALAAAIKVALSDTGIPKVNVSLSATTD
EEPEVNVSDEEFLQFDTSSVPVIVTLTKVGKHYIVDATSEEESQMSSAVSVSVNRHGQIR
GLTKRGGAGLDPSVIFDMISVAKHVSRQFISVLDSETLAAEAAE
NT seq 855 nt   +upstreamnt  +downstreamnt
atggttgggctttcggaaggagagaagcacttcatccgcgggggcatcgcgcaggacctc
cgcaccgacggccgcaggcggctgcagttccgggccatctcggtcgagaccggagtcata
cctcaggcaaacggctctgcgcgtgttagactcggtgcgactgaagtcatagctactgta
aaggctgagttggggaaaccaagcattcttcatcctgataaagggaaagtttccattttt
gttgattgcagcccaactgcagcacccatgtttgagggtagaggttctgaagaattttct
gctgagctctgtgttgcactgcaaagatgcttactcggtggtaaaagtggggcaggggct
gcaattgatttatcctcactgattgtcgttgatggaaaggtctgctgggatctctacatt
gatggacttgttgttagttctgatggaaatttgcttgatgcattggctgctgcaataaag
gtggctttgagtgatacaggtatcccaaaagtcaatgtttctcttagtgctacaacagat
gaggaacctgaagttaatgttagtgatgaagaatttttgcaatttgacacctccagtgtg
cctgttattgttacattgacgaaggtaggtaagcactacattgtggatgctacctcagag
gaagaatctcagatgagctctgcggtttcagtatcagttaataggcatggtcaaatacgt
ggattgactaagaggggcggtgcagggttggatccaagtgtcatttttgatatgatatct
gtggctaagcatgtaagtcgacaattcatctcggtattggattcggagacattagctgct
gaagcggctgagtag

DBGET integrated database retrieval system