KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352042
Entry
4352042           CDS       T01015                                 
Name
(RefSeq) 15-cis-zeta-carotene isomerase, chloroplastic
  KO
K15744  zeta-carotene isomerase [EC:5.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00097  beta-Carotene biosynthesis, GGAP => beta-carotene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    4352042
Enzymes [BR:osa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.12  zeta-carotene isomerase
     4352042
SSDB
Motif
Pfam: NnrU PEMT ICMT DUF2105
Other DBs
NCBI-GeneID: 4352042
NCBI-ProteinID: XP_015618246
UniProt: A0A8J8XAT6 Q2QT64
LinkDB
Position
12:12204433..12208019
AA seq 367 aa
MASHLLLRLPAPPPLLLHFPQRRVTLPQSRVSPTAPLLGARLVFSPASAVRPARARGSSI
GGAGEDDSDGEVDGAPRLVGEDSAAFRLGDQRVASWVYFGGILAVVLWGLNVLWIDPATG
VGTRFLEAVAAVSDNHEVTMLLLTIIFAVVHSGMASLRETGEKIIGERAYRVMFAGISLP
LAVSTVVYFINHRYDGIQLWQVQGISGIHELVWLSSFISFFFLYPSTFNLLEVAAVDKPK
FHMWETGIMRITRHPQMVGQVIWCLAHTLWIGNSVAVAASVGLIGHHLFGVWNGDRRLAS
RYGEAFEVLKKRTSVIPFAAVIDGRQKLPKDYYREFIRLPYLAITALTLGAYFVHPLMQA
SSYQLPW
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcctcccatctcctcctccgccttcccgcccctcccccgcttctcctacacttcccg
cagcggcgagtgaccctgccacagagccgggtgtcccccacggcgccgctgctcggggcc
cgcctcgtcttctccccagcctccgccgtccgtccggcccgggcgagggggtcctcgatc
ggcggcgcgggggaggacgactcagacggcgaggtggacggggccccgcgcctcgtcggg
gaggactcggcggcgttccggctgggcgaccagcgggtggcgtcgtgggtctacttcggc
gggatactcgccgtggtgctgtgggggctcaacgtgctgtggatcgacccggccaccggg
gtcgggaccaggttcctcgaggccgtcgccgccgtctccgacaaccacgaggtcactatg
ctgctccttaccatcatttttgctgtcgtccatagtggtatggcaagcttacgtgaaact
ggtgagaaaataataggggagagagcttaccgtgtaatgtttgctggaatctcactgcct
ttagcagttagtactgttgtctactttataaatcatcggtatgatggcattcagctatgg
caagttcagggtatttcaggcatccatgagcttgtttggctctcatctttcatctcattc
ttctttttgtatccatctactttcaatcttttagaagtggcagctgttgacaagccaaaa
ttccacatgtgggaaactggaataatgcgcatcactagacatccacagatggttggacag
gtaatttggtgcttagcccacacgttatggattggcaattcagttgctgttgcggcatcc
gttggattaattggtcaccatctgtttggtgtttggaatggtgataggaggctggcatca
cgctatggtgaagcctttgaagttctgaaaaagagaacaagtgttattccttttgctgca
gttatcgatggaagacagaaactacccaaagattattacagggagttcatccggttacca
tatctcgcaatcactgcattaactttgggagcatactttgttcatcccttaatgcaggcg
tccagctaccaactcccttggtga

DBGET integrated database retrieval system