KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352133
Entry
4352133           CDS       T01015                                 
Name
(RefSeq) probable signal peptidase complex subunit 1
  KO
K12946  signal peptidase complex subunit 1 [EC:3.4.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4352133
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     4352133
SSDB
Motif
Pfam: SPC12
Other DBs
NCBI-GeneID: 4352133
NCBI-ProteinID: XP_015618528
UniProt: A0A5S6R6K2
LinkDB
Position
12:complement(14503016..14503931)
AA seq 96 aa
MDWQGQKLAEMLMQLLLVASAVAAFVVGYAMADFQLMLLVYAGGVVLTALVTVPNWPFFN
RHPLKWLDAAEADRHPRPQVSATPSTVGKKKAGKNK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggattggcaggggcagaagctcgcggagatgctgatgcagctgctgctggtggcgtcg
gcggtggcggcgttcgtggtgggctacgccatggcggacttccagctcatgctgctcgtc
tacgccggcggggtcgtcctcaccgcgctcgtcaccgtcccgaactggcccttcttcaac
cgccacccgctcaagtggctcgacgccgccgaggccgaccgccacccgcgcccgcaggtc
agcgccaccccttccaccgtgggtaagaagaaggccggcaagaacaagtag

DBGET integrated database retrieval system