KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352160
Entry
4352160           CDS       T01015                                 
Name
(RefSeq) alpha-dioxygenase 1 isoform X1
  KO
K10529  fatty acid alpha-dioxygenase [EC:1.13.11.92]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4352160
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.92  fatty acid alpha-dioxygenase
     4352160
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 4352160
NCBI-ProteinID: XP_015620386
UniProt: Q2QRV3 A0A8J8Y785
Structure
LinkDB
Position
12:complement(15330146..15340526)
AA seq 618 aa
MGSGLFKPRVHPDLRDVFSKMSFFDKIGFLFIHAFDKRNLWHKVPVPIGLLYLNTRRTLL
EKYNLLAVGRSSHGALFDPKEFLYRTEDGKYNDPHNAEAGSQNTFFGRNMEPVDQQDELM
SPDPFVVATKLLARREYKDTGKQFNILAAAWIQFMVHDWMDHMEDTGQIGITAPKEVANE
CPLKSFKFHPTKELPTNSDGIKIGHYNIRTAWWDGSAVYGNNEERAEKLRTYVDGKLVIG
DDGLLLHKENGVALSGDIRNSWAGVSILQALFVKEHNAVCDAIKEEHPNLSDEELYRYAK
LVTSAVIAKVHTIDWTVELLKTKTMRAAMRANWYGLLGKKIKDTFGHIGGPILGGLVGLK
KPNNHGVPYSLTEEFTSVYRMHSLIPSTLKLRDPTGQPDANNSPPCLEDIDIGEMIGLKG
EEQLSKIGFEKQALSMGYQACGALELWNYPSFFRNLIPQNLDGTNRSDRIDLAALEVYRD
RERSVPRYNEFRRRLFLIPIKSWEDLTSDKDAIETIRAIYGDDVEKLDLLVGLMAEKKIK
GFAISETAFNIFILMASRRLEADRFFTSNFNEETYTKKGMQWVKTTEGLRDVINRHYPEI
TAKWMKSSSAFSVWDADY
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgggttcaggactcttcaagcctcgtgttcatccggacctccgtgatgttttctctaag
atgtctttctttgacaagattggctttctattcattcatgcatttgacaagagaaacctg
tggcacaaggtgcctgttccgatcggtttgctctacctgaacacccgccggaccctgctc
gaaaaatacaacctgctagctgttgggaggagttctcacggtgctctgtttgatcccaag
gagttcctgtaccgcaccgaggatggcaagtacaacgacccccataatgctgaggctggt
agccaaaacaccttttttgggagaaacatggagccggttgatcaacaggatgagttgatg
agcccagatccatttgttgtggcgacaaagctgttagccaggagagaatacaaggacaca
gggaaacagttcaatatactagcagctgcatggatacagttcatggttcatgactggatg
gatcatatggaggataccggacagattggaatcacagctccaaaagaagtggccaatgag
tgcccactcaaatcgttcaagttccaccccacaaaagaactgcctacgaattctgatgga
ataaagattggtcactacaatatccgcacagcttggtgggatgggagtgcagtatatggt
aataatgaggaaagggcagaaaagctcaggacttatgttgatggaaaactagtgatcgga
gatgacggtcttcttttgcataaggagaacggtgtggcattatccggcgacattcgcaac
agttgggctggtgtttcgatcttacaagctctttttgttaaggaacacaatgcagtttgt
gatgcaataaaggaagaacatcccaacctatcagacgaagaattatatcggtatgccaaa
ttggtcacttctgctgttattgcaaaggttcacactattgattggactgtcgagcttctc
aagacaaaaaccatgagagctgcaatgcgcgcaaattggtatggattattgggtaagaaa
ataaaagacacatttggtcacataggaggaccgatattaggtgggcttgtgggactgaag
aagccgaacaaccatggcgtaccttattctttgactgaagagtttaccagtgtttacaga
atgcactccctaataccaagcactctcaagctcagggatccgacagggcaacccgatgca
aataattccccaccatgcctggaagacatcgatattggagagatgattggtctcaagggg
gaagaacagctatcaaaaatagggtttgaaaaacaagcattatcaatgggatatcaagct
tgtggtgcacttgaactatggaactatccaagtttcttcaggaacctcattccacaaaat
ttggatggtaccaatcgatctgacagaatcgaccttgctgccctagaagtataccgagac
agggagagaagtgtaccaaggtacaatgagttcaggaggagactatttctgattccaata
aaaagctgggaggatctgacaagtgacaaggatgcaattgaaaccataagagcaatatac
ggagatgatgtagagaaattggatcttcttgttggtcttatggcagagaaaaaaatcaag
ggatttgccataagcgaaacagcattcaacattttcattttaatggcatcaaggaggctc
gaagcagatcgattttttacaagcaatttcaatgaggaaacatacaccaagaaggggatg
caatgggtcaaaacaacagaaggcctacgagatgtgatcaaccggcactaccctgaaatc
actgccaagtggatgaagtcctctagtgctttctctgtgtgggatgcagactactag

DBGET integrated database retrieval system