KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352240
Entry
4352240           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4352240 isoform X1
  KO
K25304  DNA-directed RNA polymerase III subunit RPC9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4352240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4352240
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4352240
SSDB
Motif
Pfam: RNA_pol_Rpb4
Other DBs
NCBI-GeneID: 4352240
NCBI-ProteinID: XP_015618668
UniProt: A3CHF5
LinkDB
Position
12:complement(18311000..18313120)
AA seq 140 aa
MKIEKTNAGFLTNFEVLDFLRSRGAKTDPMGCLGAVAASECKVYEYLLKTPACNQTRESI
NEFVTRCESFKLTNADKLNVINWRPSSAADAYAMIEECGKRFSKDERGEACNEDERVEEF
LELVKEAFPPPPPKPEAMIE
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaagatagagaaaacaaatgcaggatttctaacaaactttgaagtgcttgacttctta
cgatctagaggtgctaaaaccgatcccatgggatgtttgggtgctgttgctgcatcagag
tgtaaggtatatgagtaccttctaaaaactcctgcttgcaaccagacaagggaatcaatt
aacgaatttgtgacaagatgtgagagcttcaagcttacaaatgctgacaagctaaatgta
atcaattggagaccatcctcggctgctgatgcctatgcgatgatagaagagtgcggtaaa
cgattttcgaaggatgagcggggagaagcatgcaatgaagatgaacgagttgaggaattc
ttggagctagtgaaggaggcttttccaccaccacctccaaagccagaggcaatgatagag
tga

DBGET integrated database retrieval system