KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352436
Entry
4352436           CDS       T01015                                 
Name
(RefSeq) riboflavin synthase isoform X1
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4352436
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     4352436
SSDB
Motif
Pfam: Lum_binding
Other DBs
NCBI-GeneID: 4352436
NCBI-ProteinID: XP_015618419
UniProt: B7FAH8 A0A8J8YJM7
LinkDB
Position
12:21637118..21639212
AA seq 304 aa
MSPPTMTTAAAATATAMAAGVLPRPRPHFLRRGILPSPASPLPFASRVSSAAPLRHRLPP
PRFSLSPIPKTLSSPSHVPVRSLFTGIVEDVGTVRRIGPPPAPPSGGGGEAPGVDLEVET
STLLAGTQLGDSVAVDGACLTVAAIDAAASTLTFGVAPETLRRTSLGGRSAGDAVNLERA
LTPASRMGGHFVQGHVDGTGEIAAFRAEGDSLWVTVRAPPEILRLLVSKGFVAVDGASLT
VVNVDEEGGWFDFMLVRYTQDNIVLPNKKVGDKVNLEADILGKYVEKLLAGRLEAMSKAG
KRRE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcgccgccgacgatgacgaccgccgccgccgccaccgccaccgccatggccgccggc
gttctcccccgaccgcgcccgcacttcctccgccgcggcatcctcccctcgccggcctcc
ccgctccccttcgcttcccgggtctcctccgctgcgcccctccgccaccgcctcccgccg
ccgcgcttctccctctccccgatccccaagaccctctcctcgccgtcgcacgtccccgtc
cgctccctcttcaccggcatcgtcgaggacgtcggcaccgtccgccgcatcggcccgccg
cccgcgccgccctccggcggcggcggcgaggcccccggcgttgacctcgaggtggagacg
agcaccctcctcgccgggacgcagctcggggacagcgtggccgtcgacggggcctgcctc
accgtcgcggccatcgacgcggcggcgtcgacgctcaccttcggcgtcgcgccggagaca
ctccgccggacgtccctcggcggccggtccgccggcgacgccgtgaacctggagcgcgcg
ctcacgccggcgtcgcgcatggggggccacttcgtgcagggccacgtggacgggacgggg
gagatcgccgcgttccgggccgagggggactcgctctgggtcaccgtgcgcgcgccgccg
gagatcctgcggctgctggtgtccaagggcttcgtcgccgtcgacggcgcgagcctcacc
gtggtgaacgtcgacgaggaaggcgggtggttcgacttcatgctggtgaggtacacccag
gacaacatcgtgctgccgaacaagaaggttggggacaaggtgaacctcgaggccgacata
ctcggcaagtacgtcgagaagctcctcgccgggagattggaggcgatgtcgaaggcagga
aagagaagggaatga

DBGET integrated database retrieval system