KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352514
Entry
4352514           CDS       T01015                                 
Name
(RefSeq) DNA replication licensing factor MCM7
  KO
K02210  DNA replication licensing factor MCM7 [EC:5.6.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4352514
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4352514
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4352514
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4352514
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4352514
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4352514
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3
Other DBs
NCBI-GeneID: 4352514
NCBI-ProteinID: XP_015618828
UniProt: Q2QNM1
LinkDB
Position
12:complement(22954122..22959398)
AA seq 725 aa
MAATATKTIDFAAERALAKDFLANFAGPRGEPKYLNILQDVANRKIRAVQIELDDLFHYK
DADDEFLQRVTENTKRYIGIFADAIDELMPESTEAYAVDEDRDILMTQRVDEGADGGADG
TDPLQRMPPEIRRFFEVYIKAFSKVTPLTIRQVKASNIGQLVKISGIVTRCSDVKPLMQV
AVYTCEECGFEIYQEVTARVFMPLFECPSQRCKLNKAKGNLILQLRASKFLKFQEVKLQE
LAEHVPKGHIPRSLTVHLRGELTRKVAPGDVVEMSGIFLPMPYYGFRAMRAGLVADTYLE
SMSITHFKKKYEEYELKGDEQEQIDRLAEDGDIYNKLARSLAPEIFGHEDVKKALLLLLV
GAPHRKLTDGMKIRGDLHICLMGDPGVAKSQLLKHIINVAPRGVYTTGRGSSGVGLTAAV
QKDPVTNEFVLEGGALVLADMGICAIDEFDKMEESDRTAIHEVMEQQTVSIAKAGITTSL
NARTAVLAAANPAWGRYDMRRTPAENINLPPALLSRFDLLWLILDRADMETDLEMARHVV
HVHQNLESPALGFTPLEPPVLRAYISTARRVVPSVPRELEEYIATAYSSIRQEEAKSNAP
HSYTTIRTLLSILRISIALARLRFSETVAQSDVDEALRLMQMSKYSLYSDDRQRSGLDAI
SDIYSILRDEAARTNSMDVRYAHALNLISRKGYSEAQLKECLEEYASLNVWQIHPNTFDI
HFIDA
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggccgccaccgcgacgaagaccatcgacttcgccgcggagagagcgctcgccaaggac
ttcctcgccaacttcgccggcccgcgcggcgagcccaagtacctcaacatcctccaagat
gtcgcgaaccggaagatccgcgcggtccagatcgagctggacgacctgttccactacaag
gatgcggatgacgagttcttgcagagggtcacggagaacacgaagcgctacatcggcata
ttcgcggacgccatcgacgagctcatgccggagtccaccgaggcgtacgccgtcgacgag
gacagggacatcttgatgacgcagcgcgtcgacgagggagccgatggcggcgcagacggc
actgaccccctgcagaggatgccgccggagatcaggcggttctttgaggtgtacatcaag
gctttctcaaaggtgactccactcaccattaggcaagtgaaggcatccaacatcgggcag
cttgtcaaaatatctggaatcgtgactcgctgctcggatgtgaagcccttgatgcaagtt
gctgtttatacatgtgaagaatgtggttttgagatataccaggaagtgactgctagagta
tttatgcctctctttgaatgcccatctcaaaggtgcaagctgaacaaagccaaagggaat
ctaatccttcaactgcgagcatcaaaatttctgaaatttcaagaggtgaaactccaagag
ttagcagaacatgtaccaaagggtcacatcccacgttctctgactgttcatcttagagga
gagctgactagaaaggttgcacctggagatgtggttgagatgtcaggcattttcctcccc
atgccttactatggattccgagccatgcgtgcaggattggttgctgatacctacttggaa
tcaatgtctatcacccatttcaagaaaaaatatgaagaatatgaacttaaaggtgatgaa
caagaacaaattgaccgtttggctgaggatggtgatatctacaataagttggcaaggtct
ttggcacctgaaatatttggacatgaagatgtcaagaaagcactgctgttgctacttgtt
ggcgcacctcatcggaagcttacagatggcatgaagataagaggagacttgcacatatgc
ctgatgggagatcctggtgttgcaaagagtcaacttctgaagcatatcatcaatgttgct
ccaagaggagtgtataccacagggcgtggaagcagtggtgttggtcttactgctgccgtc
cagaaagatccagttacaaatgagtttgttcttgagggaggagcactggtactggcagat
atgggtatttgtgcaatagatgagtttgacaagatggaagagtcagacaggacagcaatc
catgaggtgatggagcagcagactgttagtattgcgaaggctggaatcaccacctccctc
aatgcaagaacggcagttttggctgctgcaaatccagcatggggaaggtatgatatgagg
aggaccccagctgaaaacatcaatctacctccagcacttctgtctcgttttgacctcctt
tggttgatcctggatcgcgcggacatggaaaccgatcttgaaatggcaagacatgttgtt
catgtacatcaaaaccttgaatcaccagctctggggttcacaccacttgaaccaccagtt
cttagggcatacatatctactgcgagaagagttgttccttctgttcctcgagagcttgag
gaatacattgcaactgcctattcgagcatccgccaagaggaagcaaaatcaaatgcacca
cactcctacacaactatcaggacacttttgagcatactccggatttctattgccttggca
aggcttagattctcagaaaccgtcgctcagagcgatgtcgatgaagcgcttcggctgatg
cagatgtcaaagtactccctatactcagatgaccgccagcggtctggattggacgcgatt
tctgacatatattccattctgagagatgaagctgcaagaactaacagcatggatgtcaga
tatgctcatgcccttaacttgatctccagaaagggttacagcgaggctcaactgaaggaa
tgcttggaggagtatgcttccctgaatgtttggcagatccaccccaacacctttgatatc
catttcatcgacgcgtaa

DBGET integrated database retrieval system