KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352560
Entry
4352560           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L8
  KO
K02938  large subunit ribosomal protein L8e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4352560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4352560
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4352560
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 4352560
NCBI-ProteinID: XP_015619844
UniProt: A3CIJ6 Q2QNF3
LinkDB
Position
12:23349983..23351827
AA seq 261 aa
MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK
VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPIRSVPEGAVVCNVEHHV
GDRGVFARASGDYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEKPML
KAGNAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAA
RRTGRLRGQAAATAAKADKAT
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggtcgcgtgatccgcgcgcagcgtaagggtgcgggctccgtgttcaagtcccacacc
caccaccgcaagggccccgcgaggttccgctccctcgacttcggcgagcgcaacggctac
ctcaagggcgtcgtcaccgacatcatccacgaccccggccgcggcgcgccgctcgccaag
gtgacgttccgccacccgttccggtacaagcaccagaaggagctgttcgtcgcggcggag
gggatgtacacggggcagttcgtctactgcggccgccgcgccacgctctccatcggcaac
gtgctcccgatccggtcggtacccgagggcgccgtggtctgcaacgtcgagcaccacgtc
ggcgaccgcggcgtcttcgccagggcgtccggcgactacgccatcgtcatcagccacaac
cccgataacggcacatccaggatcaagctcccctctggtgccaagaagattgtccccagc
agctgccgtgccatgatcggtcaggttgctggtggtggcaggactgagaagccgatgctc
aaggctggaaacgcctaccacaagtaccgcgtgaagaggaactgctggcctaaggtgcgt
ggtgtggccatgaaccccgttgagcatccccacggaggaggtaaccaccagcacattggt
cacgcctccaccgtccgccgtgatgcacctcctggccagaaggttggtctcatcgctgca
aggaggactggtcgtctcagaggccaggccgccgctaccgctgccaaggccgacaaggcc
acttag

DBGET integrated database retrieval system