KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352845
Entry
4352845           CDS       T01015                                 
Name
(RefSeq) anaphase-promoting complex subunit 5 isoform X1
  KO
K03352  anaphase-promoting complex subunit 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4352845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4352845
   03036 Chromosome and associated proteins [BR:osa03036]
    4352845
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     4352845
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4352845
SSDB
Motif
Pfam: ANAPC5 TPR_1 TPR_2 TPR_8 TPR_12
Other DBs
NCBI-GeneID: 4352845
NCBI-ProteinID: XP_015618125
UniProt: B9GEE1 A0A8J8Y830
LinkDB
Position
12:complement(26770724..26779097)
AA seq 916 aa
MNVFAGVGGGAAGKEAGTVGGGALLELTPHKLALCHLVQVFAPPPQAGVSAPALPFPFES
VAHHNRLGLFLFALTRSCEDFREPPLEELLRQLKAVDALVNGWLCEQLTSTLSALTSPDD
LFNFFDKLRGVLSAPEGANVEDEFLDPNSQLGVFLRCCILSFNTMTFEGVCHLLANLVEY
CNSADTSYDLAEDEDFNSEMEMSNFMDTNMHVRDGVFDKYNQGYAPRSHMVDSSSSLVHA
PASLHDFEEANMFKADDNLGPTCLRSRWQLEAYLNQQADILEKDPSSVPLNSFNATMSQL
QKLAPELHRVQFLQYLNALTHDDYVAALDNLHRYFDYSAGMQGLFSRTASPFQDIIVGKY
ESALLCLGNLHCYFGHPKKALEAFTEAVRVSQMNNDDSCLAYILGAISNLLSKIGMSSTV
GTIGSPYSLGNNIGLGTPLSIQQQLLVLLKRSLKRADTLKLTSLLSFDHLSLAKFDLKHV
QRPLVSFGPNASTKLRTCPADVCKNLRLSSRVLTDFGTDGLSASNDNGSFSTSWLRNLSA
ASNSWCSSSKKSGKLLTNDFDNFHFHAQPSPIPASVLQLAGSAYLLRATAWEHYGSAPMV
RMNSLVYATCFADAASSSELSLAYVKLIQHLATFKGYSAAFSALKLAEEKFPLSANSHIQ
LLKMQLLHERALHRGHLKVAQQICDEFAVLSSSVSGVDIELKTEARLRHARTLLAAKQFS
QAANVANSLFSTCYKYNMQVENASVLLLLAEIQKNSDNAVLGLPYALASQSFCKSFNLDL
LEASATLTLTELWLALGSTHAKRALSLVCQSLPMILGHGGLELRARAHIVLAKCYLSDPK
FSVSEDPSAVLDPLNQAAEDLEVLEYHEMAAEAYYLKAMVYNNLGKLDEREEAAASFKEH
TLALENPYNEEDSLAC
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgaacgtgttcgcgggggtgggcgggggcgcggcggggaaggaggcggggacggtgggc
ggcggggcgctgctggagctgacgccgcacaagctggcgctgtgccacctcgtgcaggtg
ttcgcgccgccgccgcaggccggggtctcggcccccgcgctgcccttccccttcgagtcc
gtcgcccaccacaaccgcctcggcctcttcctcttcgccctcacccgctcgtgcgaggat
tttcgggaacctccactggaagagcttctaaggcagctgaaggcagttgatgctttggtt
aatggctggctctgtgagcagcttacaagtaccctttcagcgcttacttcaccggatgat
ctgttcaacttctttgataagctacgaggcgttctgtctgcgccagaaggtgcaaatgtg
gaagacgaatttctggatccaaatagtcagcttggagtttttcttcgttgctgtatactt
tccttcaatacaatgacctttgagggtgtctgccatcttttggcaaatcttgtggagtat
tgtaactccgctgacacctcatacgacttggcagaagatgaggacttcaacagtgaaatg
gaaatgagcaacttcatggatacaaatatgcatgttagagatggtgtatttgacaaatac
aatcaaggttatgcccctaggagccatatggtagacagctcgtcatctctagtacatgct
ccagcctcactccatgattttgaggaagctaatatgttcaaggcagatgataacctgggt
ccaacttgtctgaggtcaagatggcaattagaggcatatcttaaccaacaagctgatatt
cttgagaaggatcctagttcggtgcctttgaattcatttaatgctactatgagtcaactt
cagaaattagctccagagctccatcgtgtccaatttttgcagtatttgaatgctcttacc
catgatgactacgttgctgcattagataatcttcaccgctattttgattacagtgcaggg
atgcaaggacttttcagtcgtaccgcgtctccattccaagatattatagttgggaagtat
gagagtgctttgctctgcttaggtaacttgcactgttattttggacatccgaagaaagcc
ttagaggcattcacagaagcagtgcgtgtttcccaaatgaacaatgatgattcatgcctg
gcctatatattaggagctatttccaatctgttatcaaagataggcatgtcaagcacagtt
ggaacaattggttctccttattcacttggaaataacatcggattaggcacaccgctgtcc
attcagcaacagctgcttgttcttttaaagagatcacttaagcgagctgataccttgaaa
cttacaagcttgctgtcctttgatcacctttctcttgcaaaatttgatctgaagcatgtc
caaaggcctctggtgtcctttggccctaatgcttccacaaagcttagaacatgtcctgca
gatgtctgcaagaatttgagattaagttcacgtgtgttgactgactttggcacagatggc
ttatcagcatcaaatgataatggtagttttagtacttcatggcttaggaatctgtctgct
gcttctaattcttggtgtagcagctcgaaaaaatctggaaaactacttacgaatgacttc
gacaatttccattttcatgcacaaccaagtcctatacctgcatcagtattgcaattagct
ggctcagcttatttgctgagggccactgcttgggaacactacgggagtgctccgatggtt
cgaatgaattcgttggtctatgcaacctgctttgctgatgctgcaagttcatcagagctg
tcgctagcatatgtcaagctaattcagcatttagcaactttcaaagggtattcagcggca
ttctctgctctcaagcttgctgaagagaagttcccgttgtcagcaaattcacatatccag
cttcttaaaatgcaattattgcacgagcgtgctctgcatcgaggacacctgaaagttgcg
caacagatctgtgatgagtttgctgtgttgtcatcttctgttagtggagtcgacattgag
ctcaagacagaagctaggttacggcatgctcgcacgcttcttgccgcaaaacaatttagt
caggcagcaaatgtggcaaattctcttttctctacttgctacaagtacaacatgcaggtg
gagaatgcaagtgttcttttattacttgcagagatacagaaaaattctgacaatgcagtc
cttgggcttccttacgcattagctagtcaatcattctgcaaatcatttaacttagatctg
cttgaagcctcggctacactaactcttactgaattatggctggctcttggatcaacccat
gcaaagagggccttgagtcttgtttgccaaagccttccaatgatccttggtcatggtgga
cttgagctgcgcgctcgagctcacatagttcttgcaaaatgctatctgtccgatccaaaa
ttctcagtttccgaagacccttctgctgttctagatcctctgaaccaagctgcggaagat
ctggaggttttggagtaccacgaaatggcggcagaagcatactacctaaaggcaatggtc
tacaacaatctaggaaaactggatgagagggaggaagctgcagcttctttcaaggagcac
acactcgcccttgaaaacccatataacgaagaggattcacttgcttgctga

DBGET integrated database retrieval system