KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352862
Entry
4352862           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABF2a
  KO
K07889  Ras-related protein Rab-5C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
osa04145  Phagosome
osa04148  Efferocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4352862
   04145 Phagosome
    4352862
   04148 Efferocytosis
    4352862
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4352862
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4352862
   04031 GTP-binding proteins [BR:osa04031]
    4352862
Membrane trafficking [BR:osa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    4352862
 Endosome - Lysosome transport
    4352862
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4352862
  Exosomal proteins of other body fluids (saliva and urine)
   4352862
  Exosomal proteins of colorectal cancer cells
   4352862
  Exosomal proteins of bladder cancer cells
   4352862
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    4352862
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA AAA_22 AAA_16 AAA_24 ATPase
Other DBs
NCBI-GeneID: 4352862
NCBI-ProteinID: XP_015619916
UniProt: Q0ILQ6
LinkDB
Position
12:27021987..27025197
AA seq 203 aa
MAANPGNKIRNAKLVLLGDVGTGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDETV
KFEIWDTAGQERYHSLAPMYYRGAAAAIVVYDITNAASFTRAKKWVQELQAQGNPNTIMA
LAGNKADMVEARQVPAEEAKTYAQENGLFFMETSAKTAINVNDVFHEIAKRLLQGQQAQD
TPAGMVLNQRPAERMVSSSSCCS
NT seq 612 nt   +upstreamnt  +downstreamnt
atggcggccaaccccggcaacaagatccgcaacgccaagctggttcttcttggagatgtg
ggcacgggcaagtcgagcctcgttctccggtttgtgaagggccagtttgttgagttccag
gagtccaccatcggcgcggccttcttctcgcaaaccttggcggttaacgatgagacggtg
aagttcgaaatctgggatactgcagggcaggagaggtatcatagcttggctccgatgtac
tatcggggtgcggctgccgcgatagttgtctacgacatcacaaatgcggcctctttcaca
cgtgcaaaaaaatgggttcaagaacttcaagcgcaaggaaacccaaacacgataatggct
cttgctggtaacaaggctgatatggtagaggcgaggcaggtgccagcagaagaggcaaag
acctacgcacaagagaatggccttttcttcatggaaacatctgcgaaaacggcgatcaat
gtgaacgatgtattccacgagatcgcaaagagattgcttcaaggacagcaggctcaagac
acaccggctggaatggttctcaaccagagaccagctgagaggatggtgagcagttcttca
tgctgctcataa

DBGET integrated database retrieval system