KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266078
Entry
9266078           CDS       T01015                                 
Name
(RefSeq) dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    9266078
   00513 Various types of N-glycan biosynthesis
    9266078
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    9266078
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     9266078
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   9266078
SSDB
Motif
Pfam: ALG3
Other DBs
NCBI-GeneID: 9266078
NCBI-ProteinID: XP_015611025
LinkDB
Position
1:complement(3705422..3709063)
AA seq 446 aa
MSSSSSSSSSSSRVLGWLDLPRAARSLAVEAAMARVGKHGESSPPSDRRPLHFAAFLLLA
DAALVALIVVFVPYTKIDWDAYMAQVDAFVEGERDYTKIEGDTGPLVYPAGFLYVYSAIK
LLTAGQVFPAQILFGVLYIVNLSLVLLMYVKTEVLPRWALGLLCLSKRVHSIFVLRLFND
CFAMTFLHAAMVLIMYHKWYLGLVIFSAAVSIKMNVLLFAPSLLLLMLKAMSIKGVFFAL
LGAAALQVLLGMPFLLSHPVEYISRAFNLGRVFIHFWSVNFKFVPEKFFVSKELAVALLV
LHLTTLLVFAHYKWLKHEGGLFHFLHSRFKDATSIGQLIFAKPKLSTLNKEHIVTVMFVG
NFIGIVCARSLHYQFYSWYFYSLPFLLWKTRFPTFVRVILFLAVELCWNIYPSTAYSSLL
LLFIHISILFGLWSSPAEYPYANGKK
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagctcctcctcctcgtcgtcgtcgtcttcgtctcgagttcttggttggttggatcta
cctcgagctgcccggagcttggctgtggaggcggccatggcgcgggtgggcaagcacggc
gagtcgtcgccgccgtccgaccgtaggccgctccacttcgcggcgttcctgctgctcgcc
gacgcggcgctcgtcgccctcatcgtcgtcttcgtcccgtataccaagatcgactgggac
gcgtacatggctcaggtggacgcgtttgtggaaggggagagggattacaccaagatcgag
ggcgacacggggccgctcgtctacccggccggcttcctctacgtttactccgccatcaag
cttctcaccgccggccaagtcttccccgcgcagattttgtttggtgtcctgtacattgtg
aaccttagccttgttctgctgatgtacgtcaagactgaagtgcttccaaggtgggcttta
ggtttgctttgcttgtcaaagagggttcactccatctttgtgctccgccttttcaacgat
tgtttcgctatgacgtttctccatgctgccatggttttgattatgtatcacaagtggtac
cttggtctagtaattttcagtgcagctgtctccattaagatgaatgtgcttctttttgct
ccatcgttattactactgatgctgaaggccatgagcatcaaaggagtcttctttgcttta
ttaggggctgcagcactacaggttttgttgggtatgccattcttgttatcacatccagtt
gagtacatctcacgagcattcaatcttgggcgtgtcttcatccatttctggtctgtaaat
tttaaatttgtccctgagaagttctttgtatcaaaagagctagctgttgcattgttggtt
cttcacctcactactcttttggtctttgcacactacaagtggcttaagcatgagggtggc
ttgttccatttcttgcattccagattcaaagatgccacatcaattggacagttaattttt
gccaagcccaaactgtcaactcttaacaaagaacatattgtaacggtcatgtttgttgga
aatttcattggcatcgtgtgcgcacgatcattacactaccaattttattcctggtacttc
tattcactgcctttccttttgtggaaaactcgttttccaacatttgtgagggtcatttta
tttcttgctgtggagctctgctggaatatctatccttccactgcctattcgtcactgctg
ttgctattcattcacatctccatcttgtttggcttatggagctcacctgcagagtacccc
tatgccaatggaaagaaatga

DBGET integrated database retrieval system