KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266155
Entry
9266155           CDS       T01015                                 
Name
(RefSeq) 5-pentadecatrienyl resorcinol O-methyltransferase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation Methyltransf_25 Dimerisation2 Methyltransf_12 DUF938 PIH1
Other DBs
NCBI-GeneID: 9266155
NCBI-ProteinID: XP_015645364
UniProt: A3BJI0
LinkDB
Position
7:complement(16314766..16319011)
AA seq 360 aa
MEHEQLLQASTELMNHSLGYIRSMALGCAAKLGVADAIHHAGGRATMDDLRAALSLHPSK
LPYFLRRVMRVLVASGVFAHDEEEDDDDIYRVTPVSSLLVTATGGNGGRSLLPFVLLQLS
PPIYVTPATSMAEWLTSGEEETPFEMTHGAGLWTVCSRDPELGELFNDAMAADSAFIMDV
AIRGAGRQVFDKITSLVDVAGGTGTAARVVAAAFPHIKCTVLDLPHVIDSIPADHRGRDV
VKFVAGDMMDFIPRADALLLKFVLHDWSDEDCMKILKRCKEAIPSREAGGKVIVIDVVVG
SSTQAMCHGTQLLFDLLISTTLPGMQRGEKEWCKVFKEAGFTDYKISPVLGIRSIIEVFP
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggagcacgagcagctactgcaagccagcacggagctcatgaaccacagcctgggctac
atcaggtccatggccctgggctgtgctgccaagctcggcgtcgccgacgccatccaccac
gccggcggccgcgccaccatggacgacctgcgcgccgcgctgtccctccacccgagcaag
ctcccgtacttcctgcgccgcgtcatgcgcgtgctggtcgcctcgggcgtcttcgcgcat
gacgaggaggaggacgacgatgatatctaccgcgtcacgcccgtgtcgtccctgctcgtc
accgccaccggcggcaacggcgggaggagcctgctgccgttcgtgctcctccagctctcg
ccgccgatctacgtgacgccggccacgagcatggccgagtggctcacgagcggcgaggag
gagacgccgttcgagatgacgcacggcgcggggctgtggaccgtctgcagccgagacccg
gagctcggcgagctgttcaacgacgccatggcggccgactcggccttcatcatggacgtg
gccatccgtggcgcgggccgccaggtgttcgacaagatcacctctcttgtggacgtcgca
ggtggcaccggcacggcggcgagggtggtggccgccgcgttcccgcatatcaagtgcacc
gtgctggaccttcctcacgtgatcgattccattccggcggaccatcgcggccgcgatgtt
gttaagtttgttgcaggagatatgatggatttcatcccccgagctgatgcactcctgctc
aagtttgtcctacacgattggagtgatgaggactgcatgaagatactaaaacgatgcaag
gaggcaattccttccagagaagcaggagggaaggtcattgtcatagatgttgtggttgga
tcctccacccaagcaatgtgccatggaacccaactgttgtttgatctgcttatttcgact
acattaccaggcatgcagagaggtgagaaagaatggtgcaaggtattcaaggaggcagga
ttcactgactacaagataagccctgtgttaggtattcgatccattatcgaagtctttcca
tag

DBGET integrated database retrieval system