KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266501
Entry
9266501           CDS       T01015                                 
Name
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    9266501
   00513 Various types of N-glycan biosynthesis
    9266501
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    9266501
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     9266501
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   9266501
SSDB
Motif
Pfam: MGAT2
Other DBs
NCBI-GeneID: 9266501
NCBI-ProteinID: XP_015625628
UniProt: A0A0P0VQP0
LinkDB
Position
2:33966068..33973012
AA seq 438 aa
MATASSHHRARLRSRAAPLLAVVVLAVLALTAILRASRHDFVPGAARAAAGVGGGGNNHT
IAQRKILLDPDFTPRLPRQSALSLSLSQRNALPPRNADRFPRLPDGHLNIVLYVHNRPRY
LRLVVDSLSRAHGIGEALLIVSHDGYFPEMDKIVQTITFCQVKQIFAPYSPHLFPEAFPG
VSSGDCQGKDKAAEKHCQGDPDQYGNHRSPRIVSLKHHWWWMMNTVWDGLDETRDFDGHI
LFIEEDHYIFPNAYRNAQLLVDLKPSKCPQCYAINLAPSDVKAKGEGWESLVAEKMGNIG
YAFNRTVWRKIHAKAKQFCTFDEYNWDITMWATVYPSFGSPVYSLRGPRRSAAHFGKCGL
HQGQGLSNVCVDNGDATVQLDAIDKVPNIKANWPVHIIKRQEGYQAGFKGWGGWGDKRDQ
ELCLSFAYMHHFKDPSSP
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggccaccgcgtcctcgcaccaccgcgcgcgcctccggtcccgcgccgcgccgctcctc
gccgtcgtcgtgctcgcggtccttgcgctgaccgccatcctccgcgccagccgccacgac
ttcgtcccgggcgcggcgcgcgccgccgccggagtcggcggcggcggcaacaaccacacc
atcgcgcagcgcaagatcctgctcgacccggacttcaccccgcggctcccgcgccagagc
gcgctctccctctccctctcccagcggaacgcgctcccgccccgcaacgccgaccgcttc
ccccgcctccccgacggccacctcaacatcgtcctctacgtccacaaccgcccccgctac
ctccgcctcgtcgtcgacagcctctcccgcgcccacggcatcggggaggcgctgctcatc
gtcagccacgacggctacttcccggagatggacaagatcgtgcagaccatcaccttctgc
caggtcaagcagatcttcgcgccctactcgccgcacctcttcccggaggccttccccggc
gtctcctccggtgactgccagggcaaggacaaggcggccgagaagcactgccagggcgac
ccggaccagtacggcaaccatcgctccccgagaatcgtctcgctcaagcaccactggtgg
tggatgatgaacaccgtgtgggatgggctggatgagaccagggacttcgatggccacatc
ctcttcatcgaggaggatcattacatcttccccaatgcgtaccgcaatgcgcagctgctt
gtcgacttgaagcctagcaagtgtccccagtgctatgctataaacttggcgccatcggat
gtcaaggcgaaaggggaaggttgggagagcttggttgccgagaagatgggtaacattggc
tatgccttcaacaggacagtttggaggaagattcatgccaaagctaagcagttctgcaca
ttcgacgagtacaattgggatataacgatgtgggcaaccgtgtatccgtcgttcggatct
cctgtttacagcctgaggggacctaggaggagcgctgcacatttcggcaagtgtggcctg
caccaaggccaaggcttgagcaatgtctgtgtggataatggcgacgcgacagtacaatta
gatgccatcgataaggtccctaacatcaaagctaactggccagtacatatcatcaagagg
caggaggggtatcaggctggcttcaaaggatggggtggctggggtgataagcgtgatcag
gagctctgtctcagttttgcatacatgcaccattttaaagacccatcatctccttga

DBGET integrated database retrieval system