KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267109
Entry
9267109           CDS       T01015                                 
Name
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    9267109
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    9267109
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     9267109
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 9267109
NCBI-ProteinID: XP_015627266
UniProt: B9F3B6
LinkDB
Position
2:4044585..4052204
AA seq 527 aa
MAMAMAMRRAAALGARHILAASSTSSSGVLLRRHMSVDAGAAMEKVRAAGLLRTQGLIGG
KWVDAYDGKTIEVQNPATGETLANVSCMGSKETSDAIASAHSTFYSWSKLTANERSKALR
KWHDLIISHKEELALLMTLEQGKPMKEALVEVTYGASFIEYFAEEAKRIYGDIIPPTLSD
RRLLVLKQPVGVVGAVTPWNFPLAMITRKVGPALACGCTVVVKPSEFTPLTALAAADLAL
QAGIPAGAINVVMGNAPEIGDALLQSTQVRKITFTGSTAVGKKLMAGSANTVKKVSLELG
GNAPCIVFDDADIDVAIKGSLAAKFRNSGQTCVCANRILVQEGIYEKFASAFIKAVQSLK
VGNGLEESTSQGPLINEAAVQKVEKFINDATSKGANIMLGGKRHSLGMSFYEPTVVGNVS
NDMLLFREEVFGPVAPLVPFKTEEDAIRMANDTNAGLAAYIFTKSIPRSWRVSEALEYGL
VGVNEGIISTEVAPFGGVKQSGLGREGSKYGMDEYLELKYICMGNLN
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcgatggcgatggcgatgcgacgcgcggcggcgctcggcgcgcgccacatcctcgcc
gcctcgtccacctcctcctccggcgtcctcctccgccgccacatgagcgtggacgcgggg
gcggcgatggagaaggtacgggcggcggggctgctccggacgcaggggctcatcggcggc
aaatgggtggacgcctacgacggcaagaccatcgaggttcaaaatccagcaactggagag
actcttgccaatgtgtcctgtatgggcagcaaagaaacatctgatgcaatagcttcagct
cacagtacattctattcttggagcaaactcactgcaaatgagaggagcaaggctctaaga
aaatggcatgatttaattatctcacacaaggaagaacttgcacttctcatgacactggag
caagggaaacctatgaaagaggctcttgttgaggtcacatatggtgcaagttttattgaa
tactttgctgaagaagcaaagcgtatatatggtgatattattcccccaactctatctgat
cgtagattattggttttgaagcagcctgttggagtagttggagctgttacaccatggaat
tttcctttagcgatgataaccagaaaggttggaccagcattggcttgtggctgcactgtc
gttgtcaagccatcagagttcacacctttgacagcacttgctgcagcagatcttgctctt
caagctggaataccagctggcgcaataaatgttgtgatgggtaatgctcctgagataggt
gatgctctactccagagtacacaggtcagaaagattacattcacagggtcaacagctgtt
ggcaaaaaactgatggctggatcagcaaatactgtgaagaaggtttctttggagcttggt
ggcaatgcaccttgcattgtttttgatgatgcagacattgatgttgccattaaaggcagt
cttgctgctaagttccgtaacagcggacagacatgtgtatgtgcaaacaggatattggtg
caagaaggtatttatgaaaaatttgcaagtgcgtttatcaaggctgttcagagtttgaag
gttggtaatgggcttgaagagagtacatcacagggccctctgatcaatgaagctgctgtt
cagaaggtagagaagttcataaatgacgccacttcaaagggagcaaacatcatgcttggt
ggtaaaaggcacagccttgggatgtcattctatgagccaactgtagtagggaacgtcagc
aatgatatgcttcttttcagggaagaagtctttggtccagttgcaccacttgtaccattc
aaaactgaggaagatgcaatccgtatggccaatgataccaacgcaggcttagctgcatat
atcttcacaaagagcatacctcgttcatggcgcgtttcggaagctcttgaatatggacta
gtcggtgtgaacgaggggatcatctcaacagaggttgcgccgtttggcggcgtcaagcaa
tctggccttgggagagaaggatcaaaatacggcatggacgagtacctggagctcaagtac
atttgcatgggaaacctgaactga

DBGET integrated database retrieval system