KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267778
Entry
9267778           CDS       T01015                                 
Name
(RefSeq) nicotianamine aminotransferase A
  KO
K14271  nicotianamine aminotransferase [EC:2.6.1.80]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    9267778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9267778
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.80  nicotianamine aminotransferase
     9267778
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Others
   9267778
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Aminotran_3 LmjF365940-deam Glyco_hydro_20
Other DBs
NCBI-GeneID: 9267778
NCBI-ProteinID: XP_015627400
UniProt: A0A0P0VI36
LinkDB
Position
2:complement(11997136..12002640)
AA seq 494 aa
MHASCCCAPPESVSHTRRISYKYSGTSYPTRTTTTSSSAPEFTNKKQSTAMAPTTAAAAA
SSNGGGESDGSSKEWRLTAPTRGGAMAAAGDKMSIRAVRYKISASVDDRGPRPVLPLAHG
DPSVFPEFRTAAEAEDAVADALRSGDFNCYPAGVGLPAARRAVADHLSRDLPYKLSSDDI
FLTAGGTQAIEVVISILAQPGTNILLPRPGYPNYEARAAFNNLEVRHFDLIPEKGWEIDL
NSLESIADKNTTAIVIINPNNPCGNVYTYEHLSKVAEVARKLGILVITDEVYGNLVFGSS
PFVPMGCFGHIVPILTIGSLSKRWIVPGWRLGWVAICDPKKTLQETKIATLITNFLNVST
DPATFIQGALPNILKNTKEEFFKRIIDLLTETSDICYRGIKDIKCITCPHKPEGSMFVMV
KLNLYLLEGIHDDVDFCCQLAKEESVILCPGSVLGMKNWVRITFAIDSSSLLDGLERIKS
FCQRHKKKNPLNYI
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgcatgcttcatgctgctgtgccccacccgagtccgtgtcccacacccgtagaatctcc
tacaaatatagcggcactagctatccgacgcgcaccaccaccacctcctcctctgcaccg
gaattcaccaacaaaaaacagagcacggccatggcaccgacgacggcggcggcggcggcg
agcagcaacggcggcggcgagagcgacggcagcagcaaggagtggaggctgacggcgccg
acgaggggcggcgcgatggcggcggcgggggacaagatgagcatccgggcggtgcggtac
aagatcagcgccagcgtcgacgaccgcggcccgcgccccgtcctgccgctcgcccacggc
gacccctccgtgttccccgagttccgcaccgccgccgaggccgaggacgccgtcgccgac
gcgctccgctccggcgacttcaactgctaccccgccggcgtcggcctccccgccgcgcga
cgtgctgtggcagatcatttgtcacgcgacctcccatacaagctatcttctgatgacatc
ttcctaaccgctggaggaactcaggccatcgaggtcgtaatctcaatccttgcccaacct
ggcacaaacatattgcttcctagaccaggctacccaaactatgaagctcgagccgcgttc
aacaaccttgaagttcgtcactttgatcttattcctgagaagggctgggagattgacctt
aactccctagaatctattgcggacaagaacactactgcgatagtcatcataaatcccaat
aatccatgcgggaatgtgtacacttacgagcatttatccaaggtggcagaggtagcaagg
aagcttgggatattggtaattactgatgaggtgtatggtaatttggtttttgggagttcc
ccatttgtcccaatgggttgctttgggcacatcgtaccaatattaaccataggatcgcta
tcaaagaggtggatagtgccgggatggcgacttggttgggtagcaatatgtgaccccaag
aagactctacaagaaaccaagattgcaacattaattactaatttccttaatgtttcaact
gatccagcaactttcattcagggagctctaccgaatattcttaagaataccaaggaagaa
ttctttaagaggataattgatttgcttacggaaacatcagatatttgctatagaggaata
aaggatattaaatgcatcacttgtcctcacaagcccgaaggatccatgtttgtgatggtg
aaattgaacctatatcttttggagggaatccatgatgatgttgatttttgttgccaactt
gcgaaagaagagtcggtgattctttgcccagggagtgtgctgggaatgaagaattgggtt
cgcattacttttgctattgattcatcttctctcctggatggtcttgagaggatcaaatcc
ttctgccaaaggcacaagaagaaaaaccctttaaattatatctag

DBGET integrated database retrieval system