KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268115
Entry
9268115           CDS       T01015                                 
Name
(RefSeq) probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial isoform X1
  KO
K23146  3-hydroxyisobutyrate/3-hydroxypropionate dehydrogenase [EC:1.1.1.31 1.1.1.59]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00410  beta-Alanine metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    9268115
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    9268115
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    9268115
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     9268115
    1.1.1.59  3-hydroxypropionate dehydrogenase
     9268115
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 2-Hacid_dh_C F420_oxidored 3HCDH_N IlvN UDPG_MGDP_dh_N TrkA_N Shikimate_DH
Other DBs
NCBI-GeneID: 9268115
NCBI-ProteinID: XP_015641275
UniProt: C7J4E1 Q653U8
LinkDB
Position
6:28139106..28142536
AA seq 342 aa
MGVVGWRVRSMVQHLGWNCRRGLSSAAVQSQLENVGFIGLGNMGAHMARNLVMAGYKVTV
HDVNENTMKKFSDDGIPTKLSPLEVSKSSDVVITMLPSSAHVLDVYNGRNGLLANGGCLG
PWLYIDSSTVDPQTSRKISMDISRCTLKEKKAYAEKPMMLDAPVSGGVPAAEAGKLTFMV
GGSEEAYLAAKPLLLSMGKKTIYCGGAGNGSVAKICNNMAMAISMLGVSEAFALGQNLGI
KASVLTDIFNCSSARCWSSDTYNPVPGVMMDVPSSRNYDGGFTSKLMTKDLDLAMASASG
VGFNCPFGSQALEIYRKLCADGCELKDFSCAFRHNYAGKDEN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgggggttgttggatggagggttcgttcgatggtccaacatttgggttggaactgtcgc
cggggcctctcgtccgctgcggttcaatctcagttggagaatgtaggattcataggactg
ggaaatatgggtgcccatatggcgaggaacctggtaatggctggatataaagtgactgtt
catgatgtcaatgagaataccatgaagaaattctcggatgatggaattcccacaaaactg
tctccacttgaagtgtccaagtctagtgatgtcgtaattacgatgctgccttcgtctgcc
catgtattagatgtatacaatggacggaatggtttgcttgctaatgggggctgccttgga
ccttggttgtatatagattcatccacagttgatccacaaacatcaaggaaaatatccatg
gacatctcaagatgcactttgaaagaaaagaaagcctatgctgaaaaaccgatgatgctg
gatgctcctgtttccggaggtgttcctgctgcagaagctgggaaactcactttcatggta
ggtggttcagaagaagcatatctagcagcaaaacccttacttctctcaatgggcaaaaaa
acaatatattgtggcggggctggaaatggctcggttgcaaagatttgtaacaacatggca
atggccatcagcatgcttggagtctccgaagcttttgctcttggtcagaatctcggcatc
aaagctagcgttcttacagacatattcaactgctcaagtgcccgctgctggagcagtgac
acatataacccagttcctggagtaatgatggatgtgccatcatcgaggaactatgatggt
ggtttcacctccaaactaatgaccaaagatttggatttggccatggcctctgcatctgga
gttggcttcaattgtccctttggttctcaggcacttgaaatttaccgaaagctatgtgct
gatggctgtgaactcaaggacttctcatgtgcatttcgccacaactatgctggcaaagat
gaaaattga

DBGET integrated database retrieval system