KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268125
Entry
9268125           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC5
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9268125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9268125
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     9268125
SSDB
Motif
Pfam: RPC5 TonB_N
Other DBs
NCBI-GeneID: 9268125
NCBI-ProteinID: XP_015650510
LinkDB
Position
8:10257626..10268933
AA seq 679 aa
MATGDDKPPSLDADIDMADLATLDAPASSDAAAAARFRPRAKGKPKPKPKPEPKAEDSKL
KADDSIPMSKPEEPKPEAAAPMEDSMEVDGVGPSASASAEGVGAEEVEDEEDYVLREIDV
YFTPKPFDEDTMLYVMQYPLRPCWRPYELNEICKEVRVKPLSSKVEVDLDINTECENYDP
EVPLPSRLTEQTLSSSKAADVADYAVGVLRGNLVHLNHIDAVMQLRPSMLHVNSGRSNAR
QAHGGASSDASGSTMPSVKRNEHSEDSKDYTEESEPWISLTYQQAGSNVARKYHAEMVSD
DGGPIDFTMSTSDYVMSLCPGGSTNSRDKNKSHAIREMLKLPLEERLKKWFTEVSQVNRF
DALMHLAPLYSEDDVLKVLPVYADLVRGLWVCKSSLLFDDGYAWKRDRILLEFRKKDSIP
LKDIHRIIKVKLDDNLKKKFLYPLCKIRAKLEDCKFVLPVDSSFIRRYPHIVKEQDHAWS
VRETTMRESQETSSNTEARKTKNTTKSNIPSKGPDPNMNKARDGPVQGNENLVHSVLDTI
FTANKVRSIQAIRRDLRQLAAKYASDRKDGPKLQALSNAATNCASFPLVDLQKSLNQVAV
PVHGVYVAKPAKPNSPRNILIKLFRDKDPDSKLTKQEILDCAANHLKKGLNEKDYHQAVT
EVCILTEDGHLVLKNGDEP
NT seq 2040 nt   +upstreamnt  +downstreamnt
atggcgaccggcgacgacaagcccccctccctcgacgccgacatcgacatggccgacctc
gccacgctcgacgcacccgcgtcctccgacgccgccgccgccgcccgcttccgccccagg
gccaagggcaagccgaagccgaagccgaagcccgagcccaaggcggaggattcgaagctc
aaggcggatgattcgattcccatgtccaagcccgaggagcccaagcctgaggctgccgcg
ccgatggaggactcgatggaggtggatggggtgggtccgagcgccagcgccagcgcggaa
ggggtgggagctgaggaggtggaggatgaggaggactacgtgctgcgggagattgacgtc
tactttacgcccaagcccttcgacgaggacaccatgctttacgtaatgcaatatccactg
aggccgtgttggcgcccatatgagctaaatgaaatatgtaaggaggttcgtgtaaagcca
ttgagttcaaaagttgaagtagacttggatatcaatacagagtgtgaaaattatgaccca
gaggttcctctgccttctagactaactgaacagacactatcatcatccaaagcagctgat
gtggctgattatgcagttggagttcttagaggcaacttggttcatttgaatcatattgat
gcagtgatgcaactgcgaccatcaatgttacatgtaaattctggtcgatcaaatgctagg
caggcacatggaggagcgagtagtgatgctagcggctcaactatgccatcagttaagcga
aatgagcactcagaagattcgaaagactacactgaagaatctgagccatggatttctctc
acttaccaacaggcagggagtaacgttgcaagaaaataccatgctgagatggtatcagat
gatggtgggcctatagatttcacaatgagcacatctgattatgtaatgtccttgtgccct
ggagggtcaacaaacagcagggataagaacaaaagccatgcaataagggaaatgcttaaa
ctgccattggaagagcgcctgaagaaatggtttaccgaggtttcacaagtgaatcgattt
gatgctctgatgcatcttgctccactctattcagaggatgatgttctcaaagtgcttcca
gtgtatgcggatttggtgcgtggtttgtgggtctgcaaaagttctttactgtttgatgat
ggatatgcttggaaaagagatagaattcttcttgaatttaggaaaaaggattccatccct
ttgaaggacatacacagaattattaaggttaagttagatgataacctaaagaaaaagttt
ctatatccattgtgtaaaataagggcaaaacttgaagactgcaaatttgtattaccagtg
gattcttccttcataagacgctatccccatatagtcaaggagcaagatcatgcttggtct
gtacgtgagacaactatgcgtgaatctcaagagacatccagcaatactgaggcaaggaaa
accaagaacacaaccaagtctaacattccttcaaaagggcctgatccaaatatgaacaag
gccagggatggtccagtgcaaggaaatgaaaacctcgtgcactctgttttggatactatt
ttcactgccaacaaagtccgcagtattcaagcaattcgtagagacttgaggcagttggca
gctaaatatgcttctgacagaaaggatggaccaaaactgcaagctctgtcaaacgctgca
acaaattgtgcttcatttcctcttgtagatctccaaaagtcactaaaccaagttgctgtt
cctgttcatggtgtgtacgttgcaaagcctgcgaagccgaatagtccacgaaatattctt
attaagctcttccgtgataaagatccagattcgaaattaaccaagcaagaaatccttgat
tgtgcagcgaatcatctaaagaaaggtctaaatgaaaaagactaccatcaggctgtcact
gaggtctgcatcttgactgaagatggacacttggtgttgaaaaatggtgatgaaccctga

DBGET integrated database retrieval system