KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268154
Entry
9268154           CDS       T01015                                 
Name
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    9268154
   00630 Glyoxylate and dicarboxylate metabolism
    9268154
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     9268154
SSDB
Motif
Pfam: Malate_synthase HpcH_HpaI
Other DBs
NCBI-GeneID: 9268154
NCBI-ProteinID: XP_015635902
UniProt: Q7XUG1
LinkDB
Position
4:complement(24325864..24328270)
AA seq 567 aa
MATNAAAPPCPCYDTPEGVDILGRYDPEFAAILTRDSLAFVAGLQREFRGAVRYAMERRR
EAQRRYDAGELPRFDPATRPVREAGGWACAPVPPAIADRTVEITGPAEPRKMVINALNSG
AKVFMADFEDALSPTWENLMRGQVNLRDAVAGTITYRDAARGREYRLGDRPATLFVRPRG
WHLPEAHVLVDGEPAIGCLVDFGLYFFHSHAAFRSGQGADFGPFFYLPKMEHSREARIWK
GVFERAEKEAGIGRGSIRATVLVETLPAVFQMEEILHELRDHSAGLNCGRWDYIFSYVKT
FRARPDRLLPDRALVGMAQHFMRSYSHLLIQTCHRRGVHAMGGMAAQIPIKDDAAANEAA
LELVRKDKLREVRAGHDGTWAAHPGLIPAIREVFEGHLGGRPNQIDAAAGDAARAGVAVT
EEDLLQPPRGARTVEGLRHNTRVGVQYVAAWLSGSGSVPLYNLMEDAATAEISRVQNWQW
LRHGAVLDAGGVEVRATPELLARVVEVEMARVEAEVGAERFRRGRYAEAGRIFSRQCTAP
ELDDFLTLDAYNLIVVHHPGASSPCKL
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggccaccaacgccgcagcgccgccgtgcccgtgctacgacacgccggagggcgtggac
atcctcggccggtacgacccggagttcgcggccatcctcacccgcgactcgctggccttc
gtggccggcctgcagcgcgagttccgcggcgccgtccggtacgccatggagcgcaggcgg
gaggcgcagcggcggtacgacgccggcgagctcccccggttcgacccggccacgaggccc
gtccgcgaggcaggcggctgggcgtgcgcccccgtgccgccggccatcgccgaccgcacc
gtcgagatcaccggccccgccgagccgcgcaagatggtcatcaacgccctcaactccggc
gccaaggtcttcatggctgacttcgaggacgcgctgtcgccgacgtgggagaacctgatg
cgcgggcaggtgaacctgcgcgacgcggttgccggcacgatcacctaccgcgacgcggcg
cgagggcgggagtacaggctcggcgaccgccccgcgacgctcttcgtgaggccgcgcggc
tggcacctccccgaggcgcacgtcctcgtcgacggcgagccggccatcggctgcctcgtc
gacttcggcctctacttcttccacagccacgccgccttccgctccggccagggcgccgac
ttcggccccttcttctacctccccaagatggagcactctagggaggcgaggatatggaag
ggggtgttcgagagggcggagaaggaggcggggatagggagggggagcatcagggcgacg
gtgctggtggagacgctgccggcggtgttccagatggaggagatcctgcacgagctgcgc
gaccactcggcggggctcaactgcggccgctgggactacatcttcagctacgtcaagacg
ttccgcgcccgccccgaccgcctcctccccgaccgcgccctcgtcggcatggcccagcac
ttcatgcgctcctactcccacctcctcatccagacctgccaccgccgcggcgtccacgcc
atgggcggcatggcggcgcagatcccgatcaaggacgacgcggcggcgaacgaggcggcg
ctggagctggtgcgcaaggacaagctgcgggaggtgcgcgccgggcacgacgggacgtgg
gcggcgcacccggggctcatcccggcgatccgggaggtgttcgagggacacctcggaggg
aggccgaaccagatcgacgcggcggctggcgacgccgcccgtgccggcgtcgccgtcacg
gaggaggacctgctccagccgccgcgcggggcgcgcacggtggagggcctgcgccacaac
acgcgcgtcggcgtgcagtacgtcgcggcgtggctatccgggtcgggctccgtgccgctg
tacaacctgatggaggacgccgccaccgcggagatcagccgggtgcagaactggcagtgg
ctccggcacggcgcggtgctggacgccggcggcgtggaggtccgggccacgcccgagctg
ctggcgcgcgtcgtggaggtggagatggcgagggtggaggccgaggtgggcgccgagagg
ttccggcgcggccggtacgcggaggccggcaggatcttcagccggcagtgcaccgcgccg
gagctggacgacttcctcacgctcgacgcgtacaacctcatcgtggtgcaccaccccgga
gcatcgtcgccgtgcaagctctga

DBGET integrated database retrieval system