KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268703
Entry
9268703           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 13
  KO
K03127  transcription initiation factor TFIID subunit 13
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    9268703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9268703
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     9268703
SSDB
Motif
Pfam: TFIID-18kDa
Other DBs
NCBI-GeneID: 9268703
NCBI-ProteinID: XP_015617807
UniProt: B9EW84 A0A8J8XSQ9
LinkDB
Position
1:13291250..13295025
AA seq 163 aa
MQNPGGHHASPASAAKSKSSTAAAASASGQGSSHHHHHHHSGGGGGGGGGADASATTLKR
KRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYVTDLVHKAQNVASKRGKLLTEDF
LYLIRKDVRKLHRATELLSMNEELKQARKAFDVNEETLATNNE
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcagaaccctggcggccaccacgctagcccggcctcggcggccaagtccaagtcctcg
accgctgccgccgcgtcggcgtcgggccaggggagctcccaccaccaccaccaccaccac
tccggcggcggcggcggcggcggcggcggcgccgacgcgtccgccaccaccctcaagcgc
aagcgcggcgtcttccagaaagacctgcagcacatgatgtacggatttggggatgatcca
aatccgcttccagaaactgttgcacttgtggaggacattgttgtagaatatgtcactgac
ctggtccacaaggcccagaacgttgcatcaaagaggggcaagctcttgacagaagatttt
ctttacctcattcgcaaggatgtgcggaaactgcaccgtgccactgagctactctccatg
aatgaagagctcaagcaggcaagaaaagcttttgatgtgaatgaagagacattggcaaca
aataacgagtga

DBGET integrated database retrieval system