KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269422
Entry
9269422           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 12
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9269422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9269422
   03400 DNA repair and recombination proteins [BR:osa03400]
    9269422
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     9269422
  RNA polymerase III system
   RNA polymerase III
     9269422
  RNA polymerase I system
   RNA polymerase I
     9269422
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      9269422
SSDB
Motif
Pfam: DNA_RNApol_7kD YjdM_Zn_Ribbon DUF5816 zinc_ribbon_13 zf-ribbon_3 OrfB_Zn_ribbon DZR HypA zinc_ribbon_2 PHD
Other DBs
NCBI-GeneID: 9269422
NCBI-ProteinID: XP_015626385
UniProt: C7J2V2
LinkDB
Position
1:19085834..19088332
AA seq 52 aa
MDPQQPEPVSYLCGDCGAENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR
NT seq 159 nt   +upstreamnt  +downstreamnt
atggatccgcaacaacctgagcccgtcagctatctctgtggagattgcggagctgagaac
acactgaagccaggagatgtgatccagtgccgtgaatgtggctatcgcatcctctacaag
aagcgtacccgccggattgttcaatatgaagcacgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272152
Entry
9272152           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 12
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9272152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9272152
   03400 DNA repair and recombination proteins [BR:osa03400]
    9272152
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     9272152
  RNA polymerase III system
   RNA polymerase III
     9272152
  RNA polymerase I system
   RNA polymerase I
     9272152
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      9272152
SSDB
Motif
Pfam: DNA_RNApol_7kD YjdM_Zn_Ribbon DUF5816 zinc_ribbon_13 zf-ribbon_3 OrfB_Zn_ribbon DZR HypA zinc_ribbon_2 PHD
Other DBs
NCBI-GeneID: 9272152
NCBI-ProteinID: XP_015638231
UniProt: C7J2V2
LinkDB
Position
5:2987556..2993096
AA seq 52 aa
MDPQQPEPVSYLCGDCGAENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR
NT seq 159 nt   +upstreamnt  +downstreamnt
atggatccgcaacaacctgagcccgtcagctatctctgtggagattgtggagctgagaac
acactgaagccaggagatgtgatccagtgccgtgaatgtggctatcgcatcctctacaag
aagcgcacccgccggattgttcaatatgaagcgcgctga

DBGET integrated database retrieval system