KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270353
Entry
9270353           CDS       T01015                                 
Name
(RefSeq) 5-oxoprolinase
  KO
K01469  5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    9270353
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     9270353
SSDB
Motif
Pfam: Hydantoinase_B Hydantoinase_A Hydant_A_N Hydant_A_C
Other DBs
NCBI-GeneID: 9270353
NCBI-ProteinID: XP_015650232
UniProt: Q8LHD1
LinkDB
Position
1:complement(42590880..42598031)
AA seq 1257 aa
MGSTEKFRFCIDRGGTFTDIYAEVPGRREGYVMKLLSVDPSNYDDAPIEGIRRILQEFSG
ERIPRSSKIPTGKIDWIRMGTTVATNALLERKGERIALCVTRGFRDLLQIGNQARPNIFD
LKVSKPSNLYEEVVEVDERVELVGGGDGERDDGLSVKGISGELVRVAKPVDVEALKPLLK
GLLDKGIRCLAVVLMHSYTYPQHELLIEKLSLEMGFKHVSLSSSLTPMVRAVPRGLTASV
DAYLTPVIKEYLSGFMSRFEGGGEQVNVLFMQSDGGLAPERRFSGHKAVLSGPAGGVVGY
SQTLFQLETSKPLIGFDMGGTSTDVSRYDGSYEQVLETQIAGAIIQAPQLDINTVAAGGG
SKLKFQFGAFKVGPDSVGAHPGPVCYRKGGELAITDANLILGTVIPEYFPSIFGPNEDLP
LDYDATKKAFEILAVEINSHRKSQDPSAKDMTVEEIALGFVNVANEAMCRPIRQLTEMKG
HDTKNHALACFGGAGPQHACAMARSLGMSELLIHRYCGILSAYGMGLADVIEDLQEPYSA
IYNVDSAAEASRRVDLLVKQVKEKLIEQGFGEDSIRTHSYLNLRYEGTDTAIMVKQPERE
SGSDYADEFVKLFQQEYGFKLLNRKILICDVRVQGVGATNILQPHELTPVSTKPVPESSC
RIYFSYGWQETPLYKLQNLGYGHVLKGPAVIMNGNSTVIVEKDCKAIITKYGNIKIEISA
APSSVEVSETVADVVQLSIFNHRFMGIAEQMGRTLQRTSISTNIKERLDFSCALFGPDGG
LVANAPHVPVHLGAMSSTVRWQLKYWGDNLHEGDVLVTNHPCSGGSHLPDITVVTPVFNE
GKVIFFVASRGHHAEIGGITPGSMPPFSKSIWEEGAAIKAFKLVERGVFQEEGIIHLLQS
PSYDELTNHKIPGTRKIQDNLSDLHAQVAANQRGITLIKELINQYGLITVQSYMNHVQNN
AEEAVREMLKVVASRVEKENGSCVIEDEDYMDDGSVLHLKLTLDSSKGEATFDFEGTSPE
VYGNWNAPEAVTAAAVIYCLRCLVDVDIPLNQGCLAPVKILIPKGSFLSPSDKAAVVGGN
VLTSQRVTDVVLMAFQACACSQGCMNNLTFGDDTFGYYETIGGGSGAGASWDGTSGVQCH
MTNTRMTDPEIFEQRYPVLLHRFSIRENSGGSGFHRGGDGLVREIEFCQPVVVSILSERR
VHAPRGLKGGRNGARGANYLVKKDGRRVYLGGKNTVMVNAGEILQILTPGGGGFGSP
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgggtagcacggagaaattcagattctgcattgacaggggcggcacattcaccgacatc
tacgcagaggtgcccgggaggagggaaggctacgtgatgaaacttctctccgtcgacccg
tcgaactacgacgacgcccccatcgaagggatcaggaggatcctccaggagttctccggg
gagaggatcccgcggtcgtccaagattcccacgggcaagattgattggattcggatgggc
accacggtggccacgaatgcgcttcttgagaggaagggtgaaaggatcgcgctgtgtgtc
acccggggattcagggatttgcttcagattggtaaccaggctcggccgaacatattcgat
ctcaaggtgtcaaagccgtcgaatttgtatgaggaggtggttgaggttgatgagagggtt
gaacttgttggtggtggtgatggtgagagggatgatggtttatctgttaaagggatctca
ggggaattggtcagggtggcgaagccggttgatgtagaagcattgaagcctttgttgaaa
ggtttgcttgacaaaggaataagatgtttggcagtggttttaatgcactcatatacttat
cctcagcatgagcttctcattgagaaattatctcttgagatgggattcaagcatgtatcg
ttgtcttcatcattgacgccgatggtccgtgctgtgcctcgtggcttgacagccagtgtg
gatgcttatctcacaccagtcatcaaagagtacctatcaggattcatgtccaggtttgaa
gggggaggtgagcaggtgaatgtgctgtttatgcagtcagatggtggtctggcaccagag
aggagattctccgggcacaaagcagtgttgtcaggtcctgcaggtggtgtggttggctac
tctcagaccttgtttcaacttgagacatcaaaaccgctgattggatttgacatgggtggt
acatccacagatgttagccgctacgatggaagctatgaacaagttctggagacccaaatt
gctggggcaataatacaagctccccagcttgacataaacacggtggctgctggtggtgga
tcgaagcttaagtttcagtttggagctttcaaggttgggccagattctgttggagcacat
cctggtcctgtatgctatagaaaaggtggtgagctggcaataactgatgccaatttgatt
ctgggaactgttattcctgagtacttcccatccatatttggtcctaacgaagatttaccc
cttgattatgacgctactaaaaaggcatttgagattcttgctgttgagataaactctcac
cgaaagagtcaggatccatcagcaaaggacatgacggttgaggagattgccctcggtttt
gttaatgttgcaaatgaggcgatgtgccgacctataaggcagttgaccgaaatgaagggg
catgacactaagaaccatgctctcgcatgctttggtggtgctggtcctcaacatgcatgt
gctatggcaagatcccttggcatgtctgagttacttattcatcgctactgtggcatattg
agtgcatatggaatgggccttgctgatgttattgaagatttgcaagagccatactctgct
atttataatgttgattctgctgcagaggcatctcgaagagtagatcttttagttaagcag
gtgaaagaaaagttaatagagcagggttttggagaggacagcatcaggacacattcatac
ttgaacttgaggtacgagggaaccgatacagcaatcatggttaaacaaccagagagggaa
tctggaagtgattatgctgatgagtttgtgaaactgtttcagcaagagtatggcttcaaa
ttattaaacagaaaaatactcatatgtgatgtgagggttcagggagttggtgctacaaat
atcttgcagcctcatgaactgacaccagtatcaaccaaacctgtgccagaaagttcatgt
cgaatttatttttcatacggatggcaggaaacaccactttacaagcttcagaatttgggc
tatgggcatgtattgaagggtcctgcagttataatgaatgggaacagtacagtgatagta
gaaaaagactgtaaagctatcatcaccaagtatggtaacataaaaattgagataagtgct
gctccaagcagtgtagaagtatcagagacagttgctgatgtggtccaactttctatcttc
aatcatcgattcatgggtattgctgaacagatgggtcgaacacttcaaagaacttctatt
tctaccaatataaaggaaagactggacttttcttgtgctctctttggtccggatggtggc
cttgtcgcaaatgcccctcatgtccctgtgcatttgggagccatgtctagcaccgtgcgt
tggcaactcaaatattggggtgataatctccatgagggtgatgttcttgtaacgaatcat
ccatgttctgggggtagccatcttccagacataacagttgtcacacctgttttcaatgaa
ggtaaagttatcttctttgttgctagtagaggtcaccatgcagagatcggtggtatcacc
ccaggaagcatgcctcctttctcaaaaagcatctgggaggaaggtgctgccatcaaagca
tttaaacttgttgagagaggtgttttccaagaggaaggaataattcacttgctacagtca
ccgtcctatgatgaacttacaaaccataagattccaggaacacgtaagatccaagataat
ctttctgacctccatgctcaggtggcagcaaaccagcggggaataacacttatcaaagaa
ctgataaatcagtatggtttgatcactgttcaatcttatatgaatcatgtccaaaacaat
gctgaagaagctgttagagaaatgcttaaggtagttgcatcgagagttgaaaaggagaat
gggtcttgtgtcatcgaagatgaagattacatggatgatggttctgtgctccatttgaag
ctcacccttgattcaagtaaaggcgaagcaacctttgactttgaaggcaccagtcctgag
gtgtatggtaactggaatgctcctgaagcagtaacagcggctgctgtgatatactgctta
cggtgcttggtcgacgttgatatacctctaaatcaaggctgcctagctcctgtgaagatc
ctaattcctaaaggctctttcctttctccaagtgacaaagctgcagtggttggtggtaat
gtattgacctctcagagagtgacggacgtagtcctaatggctttccaagcatgcgcctgc
tcccagggttgcatgaacaatttgacatttggagacgacaccttcggttactatgagacc
attggaggcggttcaggagctggggcgagttgggatggtacaagtggtgttcagtgtcac
atgacaaacacaaggatgactgacccagagatctttgagcagcgataccctgttctttta
catagatttagcatcagggagaacagtggaggttctggtttccacagaggtggtgatggc
cttgtgagagagattgaattttgccagcctgttgttgtgagcattctttcagagagaagg
gtgcatgctcccaggggactgaagggaggaagaaatggggcccgtggtgcaaactatctc
gtcaagaaagatggtcgtagagtttaccttggagggaagaacactgttatggttaatgct
ggtgagattcttcagattctcactcctggtggtggtggttttggctctccttga

DBGET integrated database retrieval system