KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270399
Entry
9270399           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase I subunit 1
  KO
K02999  DNA-directed RNA polymerase I subunit RPA1 [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9270399
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9270399
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     9270399
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     9270399
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_1 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 9270399
NCBI-ProteinID: XP_015643540
LinkDB
Position
6:24411901..24427041
AA seq 1741 aa
MADVRPDEAASEEVNSIHFSFYNDDEIKRISVKQITKSDRVDAKNCPVPGGLLDPAMGPT
NDTDTCKSCGQQSIRCPGHFGHIELAKPLFNPLLFMSLKNLLQVTCFHCHKFRLNKEQAD
RYTNELELLVRGDIAHAKNLEDLGGKVLSKEDDETEATSGDKSARSERENKTWTSIQLKE
ALSIFSKLMKKRQKKCAHCEKKNPIIKNPIYGWLIKDTTSSSVRANAIANAKLSGDGHVN
DSRETGVSGLDEELTSPGTLSRRSTNETRRISDDTIKEMVASSGKKHLLTTEVESILKDL
WKKEARFCMLLCDFQQNTLSVSEKRRGYEMFFLKNLLVAPNRFRPSISSSLGIMEHPQNV
LLSKVQESNLALQQSIAASNHMEVLRRWMDLQRNVNVLYDSSKGLSKNEKNANGIRQLLE
KKEGILRQKMMGKRVNYACRSVISPDPYLAVNEIGIPPVFATRLTYPEKVTPWNARKLQE
AINNGADIHPGATHYRDNNNMYKLQAAPPKRRAIAKMLPASRGSISQPGKDPKCEFESKV
VYRHLQDGDVVLVNRQPTLHKPSMMAHVVRVLPGEKTIRMHYANCSTYNADFDGDEMNVH
FPQDEISRAEAINIVDANKQYIGPRSGDAVRGLIQDHIIGAVLLTKLDTFLSREEYNQLV
YGSVLSSTRRSGQFGKKISIIMDDDALEPVPPAIWKPKPLWTGKQVITTILNHVTKGRPP
FTVEKKGRIEKEYLIPEERNGDKVKTINPSEQVLYVHDNELIKGMIDKAQFGNYGIVHTV
HELYGPETAGVLLSSFSRLFTMVLQLHGFTCGVDDLLLSQESDMTREEILGKSEKHSKIV
HINFTRPKKDDKAEAKAEDIRPKEGDEAEDTRPKEGDEAEDTRPKEDHEAEDSTHPKEDH
EAEDSTHPKEDHEAEGDDEDQMKLQMEVEKIIRRNGESATVILDRNMSSELNTLTSKVNK
KVFPYGLRKPFPGNCLSLMTQTGAKGGLVNMTQISSLLGQQELEGKRVPRMISGKTLPCF
PPWDTSSRAGGFIGDRFLTGLRPQEYYFHCMAGREGLVDTAVKTSRSGYLQRCLIKSLES
LKVSYDHTVRDVDGSIIQFCYGEDGVDVLKTSFLDDKFRELSDNRRALLGKLDSHNDKHL
LLNPNGYISELPEKLIENAMEFLKSKRNEKGRYDIKEKELMKLLKVKYISSLVDPGEAVG
VVAAQSIGEPSTQMTLNTFHLAGRGEMNVTLGIPRLKELLMTASAKISTPFMKCPLLEDK
TWDDDEEEMDDKLKKARDAERLAAKLRTIDDAERIAAKLRRVRVADIVERIEVCTVPFHN
NNGCVSTLYKLQLKLYPQGLYPRQSELTVEECHETLRTVFIDAMDLAISKHLDLLHKINE
IQAVKSNDMESQRSDGVEESENGPTDEDNGVSDGENEDDLGADAEKWKRQEIDEMEYDDD
AEKEEGFDMDSESEEDTKSKPESEDHQAKLDEELEESEEGHVLDSSNKGENLKAKQATAR
LEDEMNEAEDEKAQVTIKFKKNIKWTIHYESTGLNFEVHYALQEQPHILLAQIAQRTARS
VFVKACKNIDRCEVNKPKKIDNNTINTPITLQTAGVNFEVFHKLVDYLDINEVRSNDIHA
MLNTYGVEAARATIIGEVKGVFGAYGIHVDMRHLNLIADFMTFDGGYRPMSRLGMGQFST
SPFGKMTFETATKFIVEAASHGESDTLDGPSASVCLGKPVKVGTGSFGLLQNFSLEQPVA
M
NT seq 5226 nt   +upstreamnt  +downstreamnt
atggccgacgtgcggcccgacgaggccgcatcagaggaagtgaattctatccacttcagc
ttctacaatgatgatgaaattaagaggatcagtgttaaacagataacaaagtcggatcgt
gtcgatgccaagaactgtcctgtgccaggtggattacttgacccagcaatgggacccacg
aatgatactgacacctgcaagagttgtggtcagcagtccattcgctgccccggccatttt
ggccatatcgaattggcgaaaccactatttaatccattgctttttatgagtcttaaaaac
cttctccaggttacgtgcttccattgtcacaagttccggttgaacaaggaacaggcagac
agatacacaaatgagcttgaactattagtaagaggtgatattgctcatgctaaaaatttg
gaagacttgggtggcaaagtactttcgaaagaagatgatgaaactgaggccacttcaggt
gataaatcggctcgttcggagagggagaataaaacttggacatcgatccaactgaaggag
gctctttcgattttctcaaagctaatgaagaaaagacagaagaaatgtgcacattgtgaa
aaaaagaatccaattatcaaaaatcctatatatggttggttgatcaaggatacaacttct
tcctctgtaagagcaaatgcgattgccaatgctaaactgagtggagatggtcatgttaat
gactcaagagaaactggtgtttccggtcttgatgaagaactaacttcacctggtactttg
tccagaagatcaaccaatgaaacaagacgcatttctgatgatacaatcaaagaaatggtg
gcatcatcaggaaagaaacatctcttgactacagaggttgaatctattctgaaagatttg
tggaaaaaggaagcaaggttctgcatgttactatgtgatttccaacagaatacattgagt
gtatcagaaaagagaaggggctatgagatgtttttcttgaagaatctgctagtggcaccg
aacagattccgcccctcaattagctctagtcttggaatcatggaacatccacaaaatgtt
ctgctcagcaaagtgcaagagtccaatcttgcgcttcagcagagtattgctgcttctaat
catatggaagttcttagaagatggatggatctgcaaagaaatgtaaatgtgctgtatgat
agtagtaaaggcctttcaaaaaatgagaagaatgcaaatggtataaggcagttgttggaa
aagaaagaagggattcttcgacagaagatgatgggtaaaagagttaattatgcatgccgg
tccgttatatctccagatccatatttggctgttaatgaaattggaattcctcccgttttt
gccacacgattgacatatcccgagaaagtgacaccctggaatgccagaaagctacaagaa
gctataaataatggtgctgacattcatcctggcgcaacccattacagggataacaacaac
atgtacaagctacaagctgcccctcccaaacgccgtgcgattgctaagatgctacctgct
tctagaggatccatttctcaaccagggaaagatcccaagtgtgaatttgagagcaaagtg
gtatatcgacaccttcaagatggtgatgttgtactagtcaatcggcagcctactcttcac
aagcccagcatgatggcacatgttgttcgtgtgctacctggagagaagacaattcgaatg
cactatgctaattgcagcacatacaatgctgattttgatggagatgaaatgaatgtgcac
tttccacaagatgaaatatctcgtgctgaggccatcaacattgttgatgcaaataagcag
tacattggtccaaggagtggggatgctgtcagaggcctcattcaggaccacattattggt
gctgtactcctgacaaagctggacacctttctaagccgtgaggaatataatcagcttgta
tatgggtctgtgctctcttcaactcgtagatctggtcagtttggtaaaaagatatctatt
attatggatgatgatgcactcgaacctgtacctcctgctatttggaagccaaagccccta
tggacaggaaaacaggttataacaaccatcttgaaccatgtaacaaaaggtcgccctcca
tttactgtggagaagaaggggagaatcgaaaaagaatatctaatccctgaagaacgcaat
ggtgataaagttaaaactataaatccttcagagcaagttttgtatgttcatgacaatgag
ctcataaaaggcatgatagataaggcccagtttgggaactatgggatagttcatacggtt
catgaactatatggtccagagacagctggagtactactctcatcattcagtcgcttgttt
acgatggtcctgcagttgcatggatttacatgtggagtagatgatctgttactatcccaa
gagtcagatatgacgagagaggaaattcttggaaaaagtgaaaaacacagtaaaatagtg
catataaattttacacgtcccaaaaaggatgataaagctgaagctaaagctgaagatata
cgccccaaagagggtgatgaagctgaagatacacgccccaaagagggtgatgaagctgaa
gatacacgtcccaaggaggatcatgaagctgaagatagtacacatcccaaagaggatcat
gaagctgaagatagtacacatcccaaagaggatcatgaagctgaaggtgatgatgaagat
caaatgaaattgcaaatggaagtcgaaaaaattatacggaggaatggagaatctgcgact
gttatattggatagaaatatgtcaagtgaactgaatactttaacatctaaagtcaataaa
aaagtgtttccttatggtctacggaagccttttcctggaaattgtctctctcttatgact
caaactggagctaaaggtggtttggtcaacatgacacaaatttcatcattgctaggccag
caagaattagaaggaaagcgtgttccacgaatgatttctgggaagacgttaccttgcttt
ccaccgtgggatacttcttcaagagctggtggtttcatcggtgatcgatttttaactggt
ctccgtcctcaagagtactattttcactgcatggctggcagagaggggttggttgacaca
gcagtcaaaacttctcgtagtggttatcttcagcgttgtcttatcaaaagtctcgaatca
ttaaaagtctcatatgatcacacagtacgtgatgttgatggatcaatcatacagttttgc
tatggagaagatggagttgatgtgctcaaaactagctttctagacgacaaattcagggag
ctttctgataatagaagagctctccttggcaagcttgatagccacaatgacaagcacctg
ttattaaatccaaatggatacatttctgaattgcctgagaagctgattgaaaatgcaatg
gagtttctaaaatccaaaagaaatgagaaaggtcgttatgacattaaagagaaagagcta
atgaagttactgaaagtcaagtacatatctagtcttgtagatcctggggaagctgttggt
gtggttgctgctcaatccataggagaaccatcaacacagatgacgctcaacacttttcat
ctcgctggacggggtgagatgaatgttacgcttggtattcctcgtttgaaagaacttcta
atgactgcatcggctaaaattagtacaccttttatgaagtgtcctctgcttgaagataag
acttgggatgatgatgaagaagaaatggatgataaattaaagaaggcccgtgatgctgaa
cgattggctgctaaattaaggacgattgatgatgctgaacgaattgctgctaaattaagg
agggttcgtgtagctgacattgtagagagaattgaagtatgcacagttccttttcacaac
aataatggttgtgtttcaaccctgtataagttacagttgaaactctacccacaagggcta
tatccacgtcagtcagaacttacagtagaagagtgccatgaaaccttgagaactgttttt
attgatgcaatggatcttgctatcagcaaacatttagatttgctacacaaaattaatgag
atccaggcagttaagtcaaatgatatggagagtcaacggtctgatggagtcgaagaatct
gaaaatggacctactgatgaagacaatggtgtgagcgatggtgaaaatgaggatgatttg
ggagctgatgcagaaaaatggaaacggcaagagatagatgagatggagtatgatgatgat
gctgaaaaggaagagggttttgatatggatagtgaatctgaagaagataccaaatctaaa
cctgagagtgaagatcatcaagcaaaattagatgaagagttagaagagtctgaggaagga
catgtgctagattctagcaacaagggggaaaatttaaaagctaagcaagcaacagccaga
ctcgaagatgaaatgaatgaagctgaggatgaaaaggcgcaagtgaccataaagttcaag
aaaaacataaaatggactattcattatgaatcaacaggtttaaattttgaggttcactac
gctttgcaagagcaacctcatattctgttagcccagattgctcagagaacagctaggtct
gtttttgtcaaggcctgtaagaatattgatcgatgtgaagtgaataaaccaaagaagata
gataataatacgataaatactcccatcactctacaaacagcaggggtgaactttgaagta
ttccataagttagtggactatctcgatatcaatgaggtcagatccaatgatatacacgct
atgttgaacacatatggggtagaggctgcaagggcaaccatcattggggaagtgaagggc
gtattcggtgcttatggtatccatgttgacatgaggcatctgaacttgattgcggatttc
atgaccttcgacggcggttaccgaccgatgagcaggctagggatgggccagttcagcacc
tcgccatttggtaagatgacttttgagacggcaaccaagtttattgtggaagcagcttct
catggagagtctgacacactggacggcccttcggcaagcgtctgtctggggaaacctgtt
aaggtggggacgggttcctttggcttgctgcagaatttttccctggagcaacctgttgcg
atgtaa

DBGET integrated database retrieval system