KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270457
Entry
9270457           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase I subunit 2 isoform X1
  KO
K03002  DNA-directed RNA polymerase I subunit RPA2 [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9270457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9270457
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     9270457
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     9270457
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_3 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpa2_4 RNA_pol_Rpb2_2 DUF3134
Other DBs
NCBI-GeneID: 9270457
NCBI-ProteinID: XP_015614312
LinkDB
Position
10:complement(18857788..18869422)
AA seq 1174 aa
MAAGKSSSASKEDQYAALRELYRPHIDSFDYFIDEGLDKMLQSIRPVEITVPNSPTTLRI
SLEKGHLFPPKRDGRLDAPLYPQQCRQARTTYHGEFKVDTFIQCNDGPAVRQTFNFGYLP
IMLMSKLCHLRGADSEKLIFHGEEATEMGGYFICGGMERLVRILILQKRNYPMGLIRGSF
VNRGAGYTDKAVIIRCVQDDQSSVTIKLYYLLNGSARLGFWLGGREFLLPVGIVLKALID
TSDREIFTSLTCCYSDHYERGKGVVSTQLIGERAQIILDEVRDLSLFTRTECLLHLGKYF
RSVMEGFEKDDFETVAEAVLKDYIFVHLQNNHDKFNLLIFMLQKLYAIVDQTASPDKADA
LQYQEVLLPGHLITVFLKDRLQDWLRKSKRLIVEEATKNKSFDLNDSQEVRKFLSKTSAY
VGKAIQSMIKVGKVNSQSGLDLPQRDGMTIHAERLNFHRYISHFRSVHRGSSFAKMRTTS
VRKLLPESWGFLCPVHTPDGEPCGLLNHMTSTCRISSFYNSEGATKDFQKIKMSLIARLV
GAGMAQLLPRIERTGPPEVLHVHVDGCIVGSIASAKIEEVVNHLRSLKLLPHSGIPEDLE
VGYVPLSHGGAYPGLYLFTNPARFLRPVRSLLGLSNGGPNIELIGPFEQAFMEIRCPDGG
DGGRNKLFPATHEEIHPTAILSVVANLTPWSDHNQSPRNMYQCQMAKQTMGFCGQALKFR
TDVKAFHLQTPQTPIVRTATYSKYCMDEFPSGTNAIVAVLSYTGYDMEDAMILNKSAVDR
GMFRGHIFQTECIDLSAKSRDNVTEFFCKSNLSRDTTAAIESDGLPRIGENIFPNEQYYS
VCNNLTGTVRPIKLKGSEPAAIDYVAVNGTNFKDRLQKANIRLRRVRNPIIGDKFSSRHG
QKGVCSQLWPDIDMPFSANTGMRPDLIINPHAFPSRMTIAMLLESIAAKAGSLKGKFIDA
TPFASSVKERSNSIVDELGPMLASYGFNYHGTEILYSGVFGTEMKCEIFLGPVYYQRLRH
MVSDKFQVRTTGRIDQITRQPIGGRKYGGGIRFGEMERDALLAHGASYLLHDRLHSCSDY
HIADVCSICGSLLTATVIKSESQKKAKRDMLGLPTVKPPKNFACQACKTSKGMETVAMPY
VFRYLASELAAMNIKLELRLSNRTEHPTTTSEES
NT seq 3525 nt   +upstreamnt  +downstreamnt
atggcggccgggaagagctcgtcggcctccaaggaggaccagtacgcggcgctgcgggag
ctgtaccggccgcacatcgactcgttcgactacttcatcgacgaggggctcgacaagatg
cttcagtccatccgccccgtggagatcaccgtccccaactcccccaccaccctcagaata
tccttggagaaaggtcatctgttcccaccaaagagggatggtcggttggatgcaccgctc
tacccccagcagtgcaggcaggcacggacgacgtatcatggggaatttaaagtggatact
ttcatccaatgtaatgacggaccagctgtcaggcaaaccttcaattttggttacttgcct
attatgttaatgtcaaagctttgccatctaagaggtgcagattctgaaaaattgattttc
catggtgaagaggcaacagaaatgggcgggtacttcatatgtggtgggatggagagactt
gtacggattcttattttacaaaaacgtaactatcctatgggcctgatccgtggctctttc
gttaatcgtggtgctgggtacactgacaaagcagtgatcataagatgtgtccaagatgat
cagtccagtgtgacaataaagctgtattacctcctaaatggcagtgcaaggcttgggttc
tggttgggaggcagagaatttctccttcctgttgggattgttctcaaggccctaattgat
actagtgaccgggaaatatttacaagcttgacatgctgctacagtgatcattatgaaaga
ggaaagggagttgtcagcactcaacttattggtgaaagggcacaaataattcttgacgaa
gtcagagacctgtctctttttactcgcacagaatgcttgttgcatcttggaaagtacttc
cgatctgtgatggaaggatttgagaaagatgattttgaaactgttgctgaggcagttctt
aaggactatatttttgttcacctgcaaaacaaccatgacaaatttaatttattgatattt
atgctgcagaaactttatgcgattgtagatcaaactgcgtcacctgataaagctgatgct
ctacagtaccaggaagttctcttgcctggccacctgataacagtttttctaaaggataga
cttcaagattggttgagaaagtccaaacggttaattgttgaagaggctacaaaaaataaa
agctttgatctcaatgactcacaggaggtcaggaaatttctcagtaaaacttcagcatat
gttggcaaagctattcagagtatgataaaggtcggaaaagtaaattcacaatcagggcta
gatctgccacagcgagatgggatgaccattcatgctgaacggctcaactttcatcgttat
atttcgcatttccggtctgtgcataggggttctagttttgctaaaatgcgtacgacatct
gtgaggaagttgcttccagagtcatggggtttcctctgtcctgttcatacacctgatgga
gagccttgtggtttactgaaccatatgacttccacatgccgtatttcatccttttacaac
tcagaaggggcaactaaagattttcagaaaataaagatgtcacttattgctcgtttggtt
ggcgctggaatggcccaactgttgccgaggatagagcgaactggtcctccagaagtccta
catgtccatgtggatggatgcattgttggttccatcgcttctgctaagattgaagaagta
gtaaatcatcttagaagtttaaaattgcttccacattcagggattccagaggatttggaa
gtgggttatgtacccttaagccatggtggggcttatcctggactataccttttcaccaat
ccagctagatttcttcgtccggtcagaagtctcttaggtctatccaatggagggccaaat
attgagctgattggaccatttgaacaggcattcatggaaatacgatgccctgatggtggg
gatggtggaagaaacaaattatttcctgcaactcatgaagaaatccaccctacagccatt
cttagtgtagttgcaaatttgacaccttggtctgatcacaatcaaagtcctcggaacatg
taccaatgtcagatggcaaagcaaaccatgggattctgtggccaagctctaaaattccgt
actgatgtaaaagcatttcatctacagacccctcagacaccaattgtccggacagctaca
tatagcaagtattgcatggatgagttcccatccggaacaaatgctattgttgcggtgcta
tcatacacagggtatgatatggaggatgccatgattttgaataaatccgctgttgatcgt
gggatgttccgtgggcatattttccagactgagtgcattgatttatcagcaaaaagtaga
gataatgttacggagttcttttgcaagagtaatctttcgagggacactaccgctgcaatc
gaatcagatggccttcctcggattggagagaacatatttccaaatgagcagtactacagc
gtctgtaacaatctcactggtacagtaaggcctatcaaactgaagggctcagaacctgca
gctattgattatgttgctgtcaatgggacaaattttaaggatcgtctacaaaaggctaat
attcgtctgcgtcgcgtgagaaatcctataattggtgacaagttcagcagcagacatggt
caaaagggagtttgttcgcagttgtggcctgatattgatatgccattctctgctaatact
gggatgaggccagatctcatcattaatccccatgcatttccttcacgaatgactatagca
atgctcttagagtcgatagcagcaaaggccggaagtctgaaagggaagttcattgatgca
acgccttttgcaagctcagttaaagagagatcaaattccattgtggatgaactgggaccc
atgcttgcttcttatggatttaattaccatggaacagaaattctatatagtggagttttt
ggcactgagatgaaatgtgagattttccttggacctgtatactatcaacgccttcgtcat
atggtctcagacaaatttcaggttcgtaccacagggcgaatagatcagatcacaagacag
ccaataggaggaaggaaatacggtggagggattcggttcggtgagatggagcgagacgcg
cttctcgctcatggtgcctcttacctcctacatgacaggctccattcctgctccgactac
catatcgcggacgtgtgctccatctgcgggagcttgctgacggcgacggtgatcaaatcc
gaaagccagaagaaagccaagcgcgacatgctcgggctccccaccgtaaaacctcccaag
aactttgcctgccaggcctgcaaaacaagcaaagggatggagaccgtcgccatgccttac
gtcttcagatacctggcctccgagttggcggccatgaacataaagttggagcttcggctc
agcaatagaacagagcatcctactactaccagcgaagaatcctga

DBGET integrated database retrieval system