KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270806
Entry
9270806           CDS       T01015                                 
Name
(RefSeq) 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase, chloroplastic
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    9270806
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     9270806
SSDB
Motif
Pfam: His_biosynth
Other DBs
NCBI-GeneID: 9270806
NCBI-ProteinID: XP_015639697
LinkDB
Position
5:19490633..19497572
AA seq 303 aa
MASRVPSPPCAAARSGWAVPMVSVRPARSGVARGRAVVCAVIFRPCIDIHKGKVKQIVGS
TLRDSSNDGTALVTNFESDKPPAEFANIYKEDELIGGHVIMLGADPASQAAAMEALHAYP
GGLQVGGGINLENAISYLNEGASHVIVTSYVFSEGKMNIERLKQLVDLVGKHRLVLDLSC
RKKDGRYAIVTDRWQKFSDVFVDEPTLKHLAAYADEFLVHGVDVEGKRLGIDEELVELLG
RYSPIPVTYAGGVSTMDDLERIKRAGNSRVDVTVGSALDIFGGDLPYKDVVLWHKEQNMV
SQP
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcatcgagggttccgtctccaccgtgcgcggcggcgcggtccggttgggctgtcccg
atggtctccgtccggccggcgagatccggcgtggcgagaggacgtgctgtggtgtgcgcc
gttatcttcaggccgtgtatcgatattcataaggggaaagttaaacagattgttggctct
actcttcgggattcatcaaacgatggcacggcacttgttacaaattttgaatcagacaaa
cctccagcagaatttgcaaatatatataaagaggatgaacttattggtggacatgtaatc
atgcttggtgcagatcctgctagtcaagctgctgccatggaagcactacatgcatatcct
ggtggtttgcaagttggaggtggaataaatttggagaatgcgatatcttaccttaatgaa
ggtgccagtcacgtgattgttacttcttatgtgtttagtgaaggcaaaatgaacattgaa
cggctgaagcaacttgtcgatctggttgggaaacataggcttgttttggaccttagttgt
agaaaaaaggatggaagatatgccatcgtgactgacagatggcagaaattcagtgatgtc
tttgtggatgagccaacattaaaacatcttgctgcctatgcagatgaatttttggttcat
ggtgttgatgtggaggggaaaaggttaggaattgatgaagaacttgtcgaactattggga
cgttattcacctatacctgtaacttatgctgggggtgtgtctacaatggatgacctagag
aggataaaaagagcaggcaacagtcgagttgatgttacggttgggagtgcccttgatata
ttcggaggagatttgccctacaaggacgtcgttctttggcacaaggaacaaaatatggtt
agccaaccatga

DBGET integrated database retrieval system