KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272163
Entry
9272163           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor SPF27 homolog
  KO
K12861  pre-mRNA-splicing factor SPF27
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9272163
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9272163
   03400 DNA repair and recombination proteins [BR:osa03400]
    9272163
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    9272163
 Complex C
   Prp19-CDC5 complex
    9272163
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    9272163
SSDB
Motif
Pfam: BCAS2
Other DBs
NCBI-GeneID: 9272163
NCBI-ProteinID: XP_015611297
LinkDB
Position
1:9012974..9016622
AA seq 256 aa
MASSSGTREVLMLEAPPAPSGAPWRAPPDAEAVDALPYIDGDYGDPAVKREVDRMVEEEM
RRGSRKPADFLRDLPPVPAIGFENHPMLAKEYERVRAGKPPATIEMSRYGLEPPPANKRN
DVAAWRQALRNAQSQLHHQIIRIENLELMLKYGVEVWKLQNRQMESVLSRMQKMAVEYNE
KIETVNRERKFHQQNTGGQLHALTTEWQELCQKNIAIQAACVDLQNQIDQLKLGAKELGM
PIDDSTGTNQQASSAI
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcgtcgtcgtcggggacgagggaggtgctcatgctggaggccccgccggcgccctcc
ggggcgccgtggcgcgcgccgccggacgcggaggccgtggacgcgctgccctacatcgac
ggcgactacggcgacccggcggtgaagcgggaggtggaccggatggtggaggaggagatg
cggcgcgggagccgcaagcccgccgacttcctccgcgacctcccccccgtccccgccatc
gggttcgagaatcatcctatgcttgctaaagagtacgagcgtgttagagctgggaaacct
cctgctaccatagagatgtcccgctatggtttggagccacccccagcgaacaagaggaat
gatgttgctgcatggaggcaggctctaagaaatgctcagagccagctgcaccatcaaatc
ataaggatagagaatctggagcttatgctgaagtatggtgttgaggtttggaagcttcag
aatagacaaatggaatcagttttgtctaggatgcaaaagatggctgtcgaatacaatgag
aagatagaaactgtcaaccgcgagaggaaatttcaccagcaaaacactggtggtcaactc
catgccttgacgacggaatggcaggagctgtgtcagaaaaatatagctattcaagctgca
tgtgttgatctgcagaatcagattgatcagcttaaacttggagctaaagaattgggaatg
cccatcgatgacagcaccggaactaatcagcaagcatcatcagccatttga

DBGET integrated database retrieval system