KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272649
Entry
9272649           CDS       T01015                                 
Name
(RefSeq) agmatine deiminase
  KO
K10536  agmatine deiminase [EC:3.5.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    9272649
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.12  agmatine deiminase
     9272649
SSDB
Motif
Pfam: PAD_porph
Other DBs
NCBI-GeneID: 9272649
NCBI-ProteinID: XP_015636297
UniProt: B7FA89 A0A8J8YCI9
LinkDB
Position
4:23314940..23318854
AA seq 380 aa
MAKATTMEGRPAKMGFRMPAEWEPHEQCWMGWPERRDNWRELAGPARKVFARTAIAISKF
ESVTICASAKQYPYVHELMLHQPNIRVVEMSMNDCWFRDIGPTFIVRKGAPGLGITEKNI
AGIDWEFNAWGGATDGCYVDWSLDSYVAKKIVEIERIPRFPHTMVLEGGSIHVDGEGTCI
TTEECLLNPNRNPNMTKLEIENELKDFLGVAKVIWIPHGLYGDDDTNGHVDNLCCFIKPG
VVLLSWTDDENDPQYQRSVDALSTLSKSVDAKGRQIEVVKIHVPGPLYMTKEESEGVVKT
EHAIPREPGTRLAASYVNFYIANGGIVAPAFGDKWDEEACAVLQKAFPDHEVVMVEGARE
IVLAGGNIHCITQQQPVRPS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcgaaggcgacgacgatggaggggcgcccggcgaagatggggttccggatgccggcg
gagtgggagccgcacgagcagtgctggatgggctggcctgagcgtcgagacaattggcga
gagcttgctggtccagctcgaaaagtatttgcaagaactgctattgccatttcaaagttt
gagtctgttactatatgtgcaagtgccaagcagtatccctatgtccatgagctaatgcta
catcaaccaaacatcagggtggtcgagatgagcatgaatgattgctggttccgtgatatt
ggtcccacttttattgttcgtaaaggtgcaccagggttaggaatcacagaaaaaaatata
gcaggaattgattgggaatttaacgcctggggaggagccactgatggttgctatgttgat
tggagccttgacagctatgttgccaagaaaatagttgagattgagaggatccctagattt
ccacacacgatggttcttgaaggtggaagcattcatgtagatggagaaggtacatgcatc
acaacagaagaatgcttgttgaatcctaacagaaaccccaacatgaccaaactagagata
gagaatgagctgaaggattttcttggagtcgcaaaggtcatctggatacctcatgggctt
tatggtgatgatgatacaaatggtcatgttgacaatctatgctgcttcattaaacctggg
gtggtcctcttgtcatggaccgatgatgagaacgacccacagtaccaaaggtccgttgat
gcactctcaactctctccaagtccgttgatgcgaaaggacggcagatagaagttgtgaaa
atccacgtcccagggcctctgtacatgacaaaggaagagtcagagggtgttgtaaaaaca
gagcatgctataccgagggaaccaggcacgagattggctgcctcgtacgtaaacttctac
atagccaatggcggaattgtagcaccagcttttggcgacaagtgggacgaagaagcgtgt
gctgttcttcagaaggcatttcctgatcatgaggtggtgatggtggaaggcgcaagagag
atcgtgctggcagggggaaacatacactgcatcacgcagcagcagcctgtacgcccgtcg
tag

DBGET integrated database retrieval system