Ostreococcus tauri: OT_ostta02g00480 Help Entry OT_ostta02g00480  CDS       T01358                                  Name (RefSeq) Zinc finger, RING-H2-type   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ota  Ostreococcus tauri Pathway ota03420   Nucleotide excision repair ota04120   Ubiquitin mediated proteolysis ota04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ota00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     OT_ostta02g00480    04120 Ubiquitin mediated proteolysis     OT_ostta02g00480   09124 Replication and repair    03420 Nucleotide excision repair     OT_ostta02g00480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ota04121]     OT_ostta02g00480    03400 DNA repair and recombination proteins [BR:ota03400]     OT_ostta02g00480 Enzymes [BR:ota01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      OT_ostta02g00480 Ubiquitin system [BR:ota04121]  Ubiquitin ligases (E3)   UBL E3 ligases    OT_ostta02g00480   Multi subunit type E3    SCF complex     Ring finger protein      OT_ostta02g00480    Cul2 complex      OT_ostta02g00480    Cul3 complex      OT_ostta02g00480    Cul4 complex      OT_ostta02g00480    Cul7 complex      OT_ostta02g00480    Cul8 complex      OT_ostta02g00480    Cul9 complex      OT_ostta02g00480 DNA repair and recombination proteins [BR:ota03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       OT_ostta02g00480     TCR (transcription coupled repair) factors      Cul4-CSA complex       OT_ostta02g00480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-RING_5 zf-RING_16 zf-RING_11 zf-RING-like zf-C3HC4_4 PHD_NSD Prok-RING_4 zf-Nse zf-RING_Vps41 zf-RING_6 zinc_ribbon_16 Rtf2 zf-RING_10 GBBH-like_N zf_RING_Vps8 Baculo_RING TerY_C Zf_2nd_IFT121 RINGv Motif Other DBs NCBI-GeneID:  9837123 NCBI-ProteinID:  XP_022840672 OrcAE:  OT_ostta02g00480 UniProt:  A0A090M748 LinkDB All DBs Position 2:121198..121678 Genome browser AA seq 106 aa AA seqDB search MSCTTADTRFLLKKWSAVAVWSWSICTDTCAICRNSLHEGSIEYQANPAASSDDGLSIAW GNCGHVFHLDCISKWLRTRSNCPLCNKEWEFSKVEKIQLPALGLDR NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtcgtgtacgactgcagacacgcgctttctgctgaagaagtggtcagcggtagctgtc tggtcctggtcaatttgcacggacacttgtgccatctgtaggaacagtcttcacgaaggg agcattgaataccaagcaaacccagctgcatcatccgatgacggtctcagcattgcgtgg ggtaactgtggacatgttttccatctcgattgtatctcgaaatggctaaggacacgcagt aactgtccactttgcaacaaagaatgggagttctccaaggttgaaaagatacaactgccc gcacttgggcttgatagataa

DBGET integrated database retrieval system