Pygoscelis adeliae (Adelie penguin): 103922986 Help Entry 103922986         CDS       T06012                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl03260   Virion - Human immunodeficiency virus padl03264   Virion - Flavivirus and Alphavirus padl03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus padl03273   Virion - Lassa virus and SFTS virus padl04145   Phagosome padl04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:padl00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     103922986    03264 Virion - Flavivirus and Alphavirus     103922986    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     103922986    03273 Virion - Lassa virus and SFTS virus     103922986  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103922986  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103922986  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:padl04131]     103922986   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:padl04054]     103922986    04515 Cell adhesion molecules [BR:padl04515]     103922986    04090 CD molecules [BR:padl04090]     103922986    04091 Lectins [BR:padl04091]     103922986 Membrane trafficking [BR:padl04131]  Endocytosis   Phagocytosis    C-lectin receptors     103922986 Pattern recognition receptors [BR:padl04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    103922986 Cell adhesion molecules [BR:padl04515]  Lectins   Selectins and C-type lectins    103922986 CD molecules [BR:padl04090]  Proteins   103922986 Lectins [BR:padl04091]  C-Type lectins   Asialoglycoprotein and DC receptors    103922986 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  103922986 NCBI-ProteinID:  XP_009329494 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MDEEHLHDDLHVFKDRNFFRQKLRSFFTVYLLLALSFLLIITLFAVSLSRVSAISSKLNE VQPERKQNFSGRDFLLFPCGPGSREWEYFDGKCYYFSLTRMSWYKAKAQCEEMHSQLAII NSYAKQNFVMFRTRNERFWIGLTDENSEGEWEWIDGTDYKTTFTFWKEGEPNNSGNNEDC AHIWVSGKWNDVYCTYECYYVCEKPLPN NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggacgaggaacatcttcacgatgacctgcacgtttttaaagacagaaacttcttccgg cagaagctgagatcctttttcacggtatacttgctactggccctctccttcttgctgatc atcaccctgttcgctgtgtcgctctccagagtttcagccatttcttctaaactcaacgag gtgcagccggaacggaaacagaacttttctggcagggattttctgttgtttccctgcgga cccggatccagggaatgggaatacttcgatggaaaatgttactacttctccctgaccaga atgagctggtacaaggcgaaggctcagtgcgaagagatgcactcgcagttggctatcatt aacagctacgccaagcagaattttgtcatgttcaggacaaggaatgagcgtttctggatc gggctcacggacgagaattcggaaggggaatgggaatggatcgacgggaccgactataaa accacgttcacattttggaaggagggagagcccaacaacagcggcaacaacgaagactgt gcccacatctgggtctccgggaagtggaacgacgtctactgcacctatgagtgctactac gtctgcgaaaagcctctgcccaactga

DBGET integrated database retrieval system