Pseudomonas aeruginosa PAO1: PA0350 Help Entry PA0350            CDS       T00035                                  Symbol folA Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pae  Pseudomonas aeruginosa PAO1 Pathway pae00670   One carbon pool by folate pae00790   Folate biosynthesis pae01100   Metabolic pathways pae01240   Biosynthesis of cofactors pae04981   Folate transport and metabolism Module pae_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pae00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PA0350 (folA)    00670 One carbon pool by folate     PA0350 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     PA0350 (folA) Enzymes [BR:pae01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      PA0350 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  879233 NCBI-ProteinID:  NP_249041 UniProt:  Q9I6E3 LinkDB All DBs Position 393308..393814 Genome browser AA seq 168 aa AA seqDB search MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIMGRKTWDSLGRPLPGR LNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLIGGAQLYAEALPRAARL YLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAYAFEVWERR NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggcacgaccgctggcgatgatcgccgcccttggcgagaaccgcgcgatcggcatcgac aaccgcctgccctggcgcctgccggccgacctcaagcatttcaaggcgatgaccctcggc aagccggtgatcatggggcgcaagacctgggactcgctgggtcggccgctgccgggccgg ctaaacctggtggtcagccgccaggccggcctggcactggagggtgcggaagtgttcgcc agcctggacgccgcgctggcgcgcgccgaggcgtgggcgcaggcggaggacgccgacgaa ctgatgctgatcggcggcgcccagctctatgccgaggccttgccgcgcgccgcgcgtctc tacctgacccgggttggcctggcgccggagggcgacgcctttttccccgagatcgatggt gcggcctggcgcctggcgtcgagcatcgaacacgccgcggctgacgatgcgcctgcctac gccttcgaggtatgggagcgccgctga

DBGET integrated database retrieval system