Pseudomonas aeruginosa PAO1: PA0582 Help Entry PA0582            CDS       T00035                                  Symbol folB Name (RefSeq) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pae  Pseudomonas aeruginosa PAO1 Pathway pae00790   Folate biosynthesis pae01100   Metabolic pathways pae01240   Biosynthesis of cofactors Module pae_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pae00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PA0582 (folB) Enzymes [BR:pae01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PA0582 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PA0582 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PA0582 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-GeneID:  880775 NCBI-ProteinID:  NP_249273 UniProt:  Q9I5V5 LinkDB All DBs Position 641073..641426 Genome browser AA seq 117 aa AA seqDB search MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGDDLALALDYAALSERV QEFARESHFQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPAARGVGVEIERGCR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtggacagagtttttatcgaaggcttggaggtcgataccgtcatcggcgtgtacgactgg gagcgcggcatccgtcagtgcctgcgcctggacctgaccctgggctgggacaaccgtccg gccgccgcgggcgacgatctcgccctggcgctggactatgccgcgttgtccgagcgggtg caggaattcgcccgggaatcgcatttccagttggtggaaaccttcgccgagcgcctcgcc gaggtactgatgggcgagcgcggcattccctggctgcgcatccgcgtgaccaagcccggc gcggtgccggcggcccgtggcgttggcgtggagatcgaacgcggatgtcgctga

DBGET integrated database retrieval system