Pseudomonas aeruginosa M18: PAM18_0583 Help Entry PAM18_0583        CDS       T01973                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism paf  Pseudomonas aeruginosa M18 Pathway paf00790   Folate biosynthesis paf01100   Metabolic pathways paf01240   Biosynthesis of cofactors Module paf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:paf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PAM18_0583 (folB) Enzymes [BR:paf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PAM18_0583 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PAM18_0583 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PAM18_0583 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AEO73072 LinkDB All DBs Position 632060..632413 Genome browser AA seq 117 aa AA seqDB search MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGDDLALALDYAALSERV QEFARESHFQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPAARGVGVEIERGCR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtggacagagtttttatcgaaggcttggaggtcgataccgtcatcggcgtgtacgactgg gagcgcggcatccgtcagtgcctgcgcctggacctgaccctgggctgggacaaccgaccg gccgccgcgggcgacgatctcgccctggcgctggactatgccgcgttgtccgagcgggtg caggagttcgcccgggaatcgcatttccagttggtggaaaccttcgccgagcgcctcgcc gaggtactgatgggcgagcgcggcattccctggctgcgcatccgcgtgaccaagcccggc gcggtgccggcggcccgtggcgttggcgtggagatcgaacgcggatgtcgctga

DBGET integrated database retrieval system