Pteropus alecto (black flying fox): 102878395 Help Entry 102878395         CDS       T02993                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism pale  Pteropus alecto (black flying fox) Pathway pale01523   Antifolate resistance pale04010   MAPK signaling pathway pale04014   Ras signaling pathway pale04024   cAMP signaling pathway pale04062   Chemokine signaling pathway pale04064   NF-kappa B signaling pathway pale04066   HIF-1 signaling pathway pale04071   Sphingolipid signaling pathway pale04137   Mitophagy - animal pale04151   PI3K-Akt signaling pathway pale04210   Apoptosis pale04211   Longevity regulating pathway pale04218   Cellular senescence pale04380   Osteoclast differentiation pale04613   Neutrophil extracellular trap formation pale04620   Toll-like receptor signaling pathway pale04621   NOD-like receptor signaling pathway pale04622   RIG-I-like receptor signaling pathway pale04623   Cytosolic DNA-sensing pathway pale04625   C-type lectin receptor signaling pathway pale04657   IL-17 signaling pathway pale04658   Th1 and Th2 cell differentiation pale04659   Th17 cell differentiation pale04660   T cell receptor signaling pathway pale04662   B cell receptor signaling pathway pale04668   TNF signaling pathway pale04722   Neurotrophin signaling pathway pale04917   Prolactin signaling pathway pale04920   Adipocytokine signaling pathway pale04926   Relaxin signaling pathway pale04931   Insulin resistance pale04932   Non-alcoholic fatty liver disease pale04933   AGE-RAGE signaling pathway in diabetic complications pale04936   Alcoholic liver disease pale05010   Alzheimer disease pale05022   Pathways of neurodegeneration - multiple diseases pale05030   Cocaine addiction pale05132   Salmonella infection pale05133   Pertussis pale05134   Legionellosis pale05135   Yersinia infection pale05140   Leishmaniasis pale05142   Chagas disease pale05145   Toxoplasmosis pale05146   Amoebiasis pale05152   Tuberculosis pale05160   Hepatitis C pale05161   Hepatitis B pale05162   Measles pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05165   Human papillomavirus infection pale05166   Human T-cell leukemia virus 1 infection pale05167   Kaposi sarcoma-associated herpesvirus infection pale05168   Herpes simplex virus 1 infection pale05169   Epstein-Barr virus infection pale05170   Human immunodeficiency virus 1 infection pale05171   Coronavirus disease - COVID-19 pale05200   Pathways in cancer pale05202   Transcriptional misregulation in cancer pale05203   Viral carcinogenesis pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05212   Pancreatic cancer pale05215   Prostate cancer pale05220   Chronic myeloid leukemia pale05221   Acute myeloid leukemia pale05222   Small cell lung cancer pale05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pale05321   Inflammatory bowel disease pale05415   Diabetic cardiomyopathy pale05417   Lipid and atherosclerosis pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102878395 (RELA)    04014 Ras signaling pathway     102878395 (RELA)    04064 NF-kappa B signaling pathway     102878395 (RELA)    04668 TNF signaling pathway     102878395 (RELA)    04066 HIF-1 signaling pathway     102878395 (RELA)    04071 Sphingolipid signaling pathway     102878395 (RELA)    04024 cAMP signaling pathway     102878395 (RELA)    04151 PI3K-Akt signaling pathway     102878395 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102878395 (RELA)   09143 Cell growth and death    04210 Apoptosis     102878395 (RELA)    04218 Cellular senescence     102878395 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102878395 (RELA)    04620 Toll-like receptor signaling pathway     102878395 (RELA)    04621 NOD-like receptor signaling pathway     102878395 (RELA)    04622 RIG-I-like receptor signaling pathway     102878395 (RELA)    04623 Cytosolic DNA-sensing pathway     102878395 (RELA)    04625 C-type lectin receptor signaling pathway     102878395 (RELA)    04660 T cell receptor signaling pathway     102878395 (RELA)    04658 Th1 and Th2 cell differentiation     102878395 (RELA)    04659 Th17 cell differentiation     102878395 (RELA)    04657 IL-17 signaling pathway     102878395 (RELA)    04662 B cell receptor signaling pathway     102878395 (RELA)    04062 Chemokine signaling pathway     102878395 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102878395 (RELA)    04917 Prolactin signaling pathway     102878395 (RELA)    04926 Relaxin signaling pathway     102878395 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102878395 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     102878395 (RELA)   09149 Aging    04211 Longevity regulating pathway     102878395 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102878395 (RELA)    05202 Transcriptional misregulation in cancer     102878395 (RELA)    05207 Chemical carcinogenesis - receptor activation     102878395 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     102878395 (RELA)    05203 Viral carcinogenesis     102878395 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102878395 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     102878395 (RELA)    05221 Acute myeloid leukemia     102878395 (RELA)    05220 Chronic myeloid leukemia     102878395 (RELA)    05215 Prostate cancer     102878395 (RELA)    05222 Small cell lung cancer     102878395 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102878395 (RELA)    05170 Human immunodeficiency virus 1 infection     102878395 (RELA)    05161 Hepatitis B     102878395 (RELA)    05160 Hepatitis C     102878395 (RELA)    05171 Coronavirus disease - COVID-19     102878395 (RELA)    05164 Influenza A     102878395 (RELA)    05162 Measles     102878395 (RELA)    05168 Herpes simplex virus 1 infection     102878395 (RELA)    05163 Human cytomegalovirus infection     102878395 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     102878395 (RELA)    05169 Epstein-Barr virus infection     102878395 (RELA)    05165 Human papillomavirus infection     102878395 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102878395 (RELA)    05135 Yersinia infection     102878395 (RELA)    05133 Pertussis     102878395 (RELA)    05134 Legionellosis     102878395 (RELA)    05152 Tuberculosis     102878395 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     102878395 (RELA)    05145 Toxoplasmosis     102878395 (RELA)    05140 Leishmaniasis     102878395 (RELA)    05142 Chagas disease     102878395 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     102878395 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     102878395 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     102878395 (RELA)   09165 Substance dependence    05030 Cocaine addiction     102878395 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102878395 (RELA)    05418 Fluid shear stress and atherosclerosis     102878395 (RELA)    05415 Diabetic cardiomyopathy     102878395 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102878395 (RELA)    04932 Non-alcoholic fatty liver disease     102878395 (RELA)    04931 Insulin resistance     102878395 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     102878395 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102878395 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pale03000]     102878395 (RELA) Transcription factors [BR:pale03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     102878395 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  102878395 NCBI-ProteinID:  XP_024902067 LinkDB All DBs Position Unknown AA seq 718 aa AA seqDB search AAFRPFLRRWALRRERPAGWWCGAGQALRGLTQFPPWVEGALTQYPPWVGGEGELRLSSP LHLLPGAHGDSSDCFLFRGENQIQCSLRIPGGQCRPLVFFRKVEKALTQFPPVKRARHAQ CSLRKQVFLAALLLPLSFSAGSREQALTQFPWEALPGEDGKWACADPCLPPISDLFPLIF PSEPAPASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGP GTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQA INQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVLSHPIFDNRAP NTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVA IVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETF KSIMKKSPFNGPTDPRPPPRRIAVPSRNSTSVPKPAPQSYPFTPSLSTINFEEFAPVVFS SGQMPSQTPALAPVPAPVLAHVPAPAPAMASALPQASTPVPVLASGLGQAVAPPAPKPTQ AGEGTLSEALLQLQFDADEDLGSLLGNNTDPAVFSDLASVDNSEXXXXXXXXXXXXXXML MEYPESITRLVTGSQRPPDPAPTPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt gccgccttccgtcccttcctgcgccgatgggcgctgcgcagggagcggccggccggatgg tggtgcggggcggggcaggcgttgaggggtctgactcaatttcccccctgggtggagggg gctttgactcagtatcctccttgggtgggcggggagggtgaactccgactcagttccccc ctccacctcctccccggcgcccatggggacagttctgactgtttcctttttaggggagaa aatcagattcagtgttctctcaggatcccgggcgggcagtgtcgtcccttagttttcttt aggaaagtagaaaaggccctgactcagtttcctccagtaaagagagcgcgccatgcccag tgttctcttaggaaacaggtgtttctggctgctttactcctacccctcagtttcagtgca ggctccagagagcaggccctgactcagtttccctgggaggctctcccgggtgaggacggg aagtgggcttgtgctgacccttgtctccctcctatttcagacctgttccccctcatcttc ccctctgaaccagccccggcctccggcccctatgtggaaatcatcgagcagcccaagcag cggggcatgcgcttccgctacaagtgcgagggtcgctcagcaggcagtatccccggcgag aggagcacggacaccaccaagacccaccccaccatcaagatcaatggctacacgggacca gggacagttcgcatctccttggtcaccaaggacccccctcaccggccgcacccccatgag ctggtggggaaagactgccgggatggcttctatgaggctgagctctgcccggaccgctgc atccacagcttccagaacctggggatccagtgtgtgaagaagcgggacctggaacaggcc atcaatcagcgcatccagaccaacaacaaccccttccaagttcccatagaagagcagcgt ggggactacgacttgaatgctgttcggctctgcttccaggtgacagtgcgggacccgtca ggcaggcccctccgcctgtcacctgtcctctctcatcccatctttgacaaccgcgccccc aacacagcagagctcaagatctgccgagtgaaccgcaactccgggagctgcctcggtggg gatgagattttcctgctgtgtgacaaggtgcagaaagaggacattgaggtgtacttcact ggaccgggctgggaggcccgaggctccttttcgcaagccgatgtccatcgacaagtggct attgtgttccggacccctccgtatgccgaccccagcttgcaggcccccgtgcgtgtctcc atgcagctgcggcggccttcagatcgggagctcagcgagcccatggaattccagtacttg ccagacacagacgaccgtcaccggattgaggagaaacgtaaaaggacatatgagaccttc aagagcatcatgaaaaagagtcctttcaatggacccactgacccccggcctccaccccgg cgcattgctgtgccttcccgcaactccacttccgtccccaagccagctccccagtcctat ccctttacgccatccctcagcaccatcaactttgaggagtttgcccctgtggtcttttcc tctgggcagatgccaagccagaccccagccttggcgccagtccctgccccagtcctggcc cacgtgccagcccctgccccagccatggcatcagctctgcctcaggcctcaacccctgtc ccagttctagcctcaggccttggtcaggctgtggccccgcctgctcccaagcccacccag gctggggaaggaacactgtcggaggccctgctgcagctgcagtttgatgctgatgaagac ctggggtctctgctcggcaataacactgacccagctgtgttctcggacctggcatctgtc gacaactccgagttnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncatgctg atggagtatcctgagtctataactcgcctggtgacagggtcccagaggcctcctgaccca gcgcccactcccctgggggcctctgggctccccaacggcctcctctcaggagatgaagac ttctcctctattgcagatatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system