Pteropus alecto (black flying fox): 102883778 Help Entry 102883778         CDS       T02993                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism pale  Pteropus alecto (black flying fox) Pathway pale04010   MAPK signaling pathway pale04014   Ras signaling pathway pale04015   Rap1 signaling pathway pale04024   cAMP signaling pathway pale04062   Chemokine signaling pathway pale04510   Focal adhesion pale04520   Adherens junction pale04611   Platelet activation pale04670   Leukocyte transendothelial migration pale04720   Long-term potentiation pale04722   Neurotrophin signaling pathway pale04934   Cushing syndrome pale04972   Pancreatic secretion pale05211   Renal cell carcinoma pale05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102883778 (RAP1B)    04014 Ras signaling pathway     102883778 (RAP1B)    04015 Rap1 signaling pathway     102883778 (RAP1B)    04024 cAMP signaling pathway     102883778 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102883778 (RAP1B)    04520 Adherens junction     102883778 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102883778 (RAP1B)    04670 Leukocyte transendothelial migration     102883778 (RAP1B)    04062 Chemokine signaling pathway     102883778 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     102883778 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     102883778 (RAP1B)    04722 Neurotrophin signaling pathway     102883778 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     102883778 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102883778 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102883778 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102883778 (RAP1B)    04031 GTP-binding proteins [BR:pale04031]     102883778 (RAP1B) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102883778 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    102883778 (RAP1B)   Exosomal proteins of colorectal cancer cells    102883778 (RAP1B) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     102883778 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  102883778 NCBI-ProteinID:  XP_006923783 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaattttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcagaatctagcaagacaatggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatca tgtcagctcctttaa

DBGET integrated database retrieval system