Pteropus alecto (black flying fox): 102885942 Help Entry 102885942         CDS       T02993                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pale  Pteropus alecto (black flying fox) Pathway pale00510   N-Glycan biosynthesis pale00513   Various types of N-glycan biosynthesis pale04141   Protein processing in endoplasmic reticulum Module pale_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     102885942    00513 Various types of N-glycan biosynthesis     102885942  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102885942 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Phage_T4_Y06M Motif Other DBs NCBI-GeneID:  102885942 NCBI-ProteinID:  XP_006917033 UniProt:  L5K9S6 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELKAMSRYTSSVNLAVFPHLTMVLWAIHMFSTAWFFIYEVTSTKYTRDIYKQLLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcaaggccatgagcagatacaccagctcagtgaacctggctgtcttcccccat ctgaccatggtgctgtgggccattcacatgttctccactgcctggttcttcatttatgag gtcacctccaccaagtacactcgggacatctacaaacagctcctcatctccttggtggcg tcactcttcatgggctttggagtcctcttcctgctgctctgggtcggcatctatgtatga

DBGET integrated database retrieval system