Pteropus alecto (black flying fox): 102887289 Help Entry 102887289         CDS       T02993                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04061   Viral protein interaction with cytokine and cytokine receptor pale04068   FoxO signaling pathway pale04148   Efferocytosis pale04625   C-type lectin receptor signaling pathway pale04630   JAK-STAT signaling pathway pale04660   T cell receptor signaling pathway pale04672   Intestinal immune network for IgA production pale05133   Pertussis pale05135   Yersinia infection pale05140   Leishmaniasis pale05142   Chagas disease pale05143   African trypanosomiasis pale05144   Malaria pale05145   Toxoplasmosis pale05146   Amoebiasis pale05150   Staphylococcus aureus infection pale05152   Tuberculosis pale05310   Asthma pale05320   Autoimmune thyroid disease pale05321   Inflammatory bowel disease pale05322   Systemic lupus erythematosus pale05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102887289 (IL10)    04068 FoxO signaling pathway     102887289 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102887289 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     102887289 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     102887289 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102887289 (IL10)    04660 T cell receptor signaling pathway     102887289 (IL10)    04672 Intestinal immune network for IgA production     102887289 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102887289 (IL10)    05133 Pertussis     102887289 (IL10)    05150 Staphylococcus aureus infection     102887289 (IL10)    05152 Tuberculosis     102887289 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     102887289 (IL10)    05144 Malaria     102887289 (IL10)    05145 Toxoplasmosis     102887289 (IL10)    05140 Leishmaniasis     102887289 (IL10)    05142 Chagas disease     102887289 (IL10)    05143 African trypanosomiasis     102887289 (IL10)   09163 Immune disease    05310 Asthma     102887289 (IL10)    05322 Systemic lupus erythematosus     102887289 (IL10)    05320 Autoimmune thyroid disease     102887289 (IL10)    05321 Inflammatory bowel disease     102887289 (IL10)    05330 Allograft rejection     102887289 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102887289 (IL10)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102887289 (IL10) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Interleukins    102887289 (IL10) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Cytokines    102887289 (IL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 CLZ Motif Other DBs NCBI-GeneID:  102887289 NCBI-ProteinID:  XP_006922887 UniProt:  L5JYH4 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MPSSALLCCLVFLAGVGASRDQRTPSENSCTHFPASLPSMLHELRAAFDKVKAFFQMKDQ LDNILLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAESQGPDIKKHVNSLGEKLKTLR LRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKMKK NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcccagctcagcactgctctgttgcctggtcttcctggccggggtgggggccagccga gaccagcgcaccccgtctgagaacagctgcacccacttcccagccagcctgcccagcatg cttcacgagctccgagctgcctttgacaaggtgaaggctttctttcaaatgaaggaccag ctggacaacatattgctgaacgggtccttgctggaggactttaagggttacctgggttgc caagccttgtcggagatgatccaattttacctggaggaggtgatgccccaggctgagagc cagggcccagacatcaagaaacacgtgaactcccttggggaaaagctgaagacactcagg ctgaggcttcggcgctgccatcgctttctaccctgtgagaataagagcaaagcagtggag caggtgaagagcgcttttagtaagctccaagagaaaggggtctacaaagccatgagtgag tttgacatcttcatcaactacatagaagcctacatgacaatgaagatgaaaaagtaa

DBGET integrated database retrieval system